Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0153 [new locus tag: SACOL_RS00775 ]
- pan locus tag?: SAUPAN001002000
- symbol: SACOL0153
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0153 [new locus tag: SACOL_RS00775 ]
- symbol: SACOL0153
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 170371..170754
- length: 384
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237873 NCBI
- RefSeq: YP_185053 NCBI
- BioCyc: see SACOL_RS00775
- MicrobesOnline: 911630 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGCGACTTATTTTAATCGTCATTGGCTTAATATTTACAGCGCTTGGTATTGCAGGTGCC
GTATTACCTTTACTGCCAACGACCCCTTTTTTACTCGTAGCAGTTTTTTGTTTTGCTCGA
AGTTCAGATCGCTTTTACAATTGGCTTATTAATCAAAAAATTTATAAAGAATATGTAGAA
AACTTTTATTTACATCGAGGCTACACGCTACAACAGAAAATTAAAATTTTAATTAGCTTA
TACATTGTAATAGGTTTTTCAATTTATATGGTGGATGTTCTTGCAGTCCGTGTAGGATTA
ATCATAATGGTTATCATACAAACCGCTGTACTCTTTACATTTGTAAAAACATTACCCAAA
TCAAATCATAAAATAGAGGAGTGA60
120
180
240
300
360
384
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0153 [new locus tag: SACOL_RS00775 ]
- symbol: SACOL0153
- description: hypothetical protein
- length: 127
- theoretical pI: 9.99954
- theoretical MW: 14569.6
- GRAVY: 0.922047
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG039061: hypothetical protein related to heme utilization
Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives FIG039061: hypothetical protein related to heme utilizationand 1 more - PFAM: no clan defined DUF454; Protein of unknown function (DUF454) (PF04304; HMM-score: 127)and 4 moreGlyoxalase (CL0104) Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 16.8)SLATT (CL0676) DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 14.3)no clan defined Proho_convert; Prohormone convertase enzyme (PF12177; HMM-score: 10.2)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9976
- Cell wall & surface Score: 0
- Extracellular Score: 0.0023
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.132098
- TAT(Tat/SPI): 0.018801
- LIPO(Sec/SPII): 0.154716
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPKSNHKIEE
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]