From AureoWiki
Jump to navigation Jump to search

NCBI: 06-JUL-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0112 [new locus tag: NWMN_RS00620 ]
  • pan locus tag?: SAUPAN001002000
  • symbol: NWMN_0112
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: NWMN_0112 [new locus tag: NWMN_RS00620 ]
  • symbol: NWMN_0112
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 136435..136818
  • length: 384
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGCGACTTATTTTAATCGTCATTGGCTTAATATTTACAGCGCTTGGTATTGCAGGTGCC
    GTATTACCTTTACTGCCAACGACCCCTTTTTTACTCGTAGCAGTTTTTTGTTTTGCTCGA
    AGTTCAGATCGCTTTTACAATTGGCTTATTAATCAAAAAATTTATAAAGAATATGTAGAA
    AACTTTTATTTACATCGAGGCTACACGCTACAACAGAAAATTAAAATTTTAATTAGCTTA
    TACATTGTAATAGGTTTTTCAATTTATATGGTGGATGTTCTTGCAGTCCGTGTAGGATTA
    ATCATAATGGTTATCATACAAACCGCTGTACTCTTTACATTTGTAAAAACATTACCCAAA
    TCAAATCATAAAATAGAGGAGTGA
    60
    120
    180
    240
    300
    360
    384

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: NWMN_0112 [new locus tag: NWMN_RS00620 ]
  • symbol: NWMN_0112
  • description: hypothetical protein
  • length: 127
  • theoretical pI: 9.99954
  • theoretical MW: 14569.6
  • GRAVY: 0.922047

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Iron acquisition and metabolism Iron acquisition and metabolism - no subcategory Heme, hemin uptake and utilization systems in GramPositives  FIG039061: hypothetical protein related to heme utilization
  • PFAM:
    no clan defined DUF454; Protein of unknown function (DUF454) (PF04304; HMM-score: 127.5)
    and 3 more
    Glyoxalase (CL0104) Glyoxalase_2; Glyoxalase-like domain (PF12681; HMM-score: 16.7)
    no clan defined DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 13.1)
    DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 5.5)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.132098
    • TAT(Tat/SPI): 0.018801
    • LIPO(Sec/SPII): 0.154716
  • predicted transmembrane helices (TMHMM): 3

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MRLILIVIGLIFTALGIAGAVLPLLPTTPFLLVAVFCFARSSDRFYNWLINQKIYKEYVENFYLHRGYTLQQKIKILISLYIVIGFSIYMVDVLAVRVGLIIMVIIQTAVLFTFVKTLPKSNHKIEE

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]