Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0156 [new locus tag: SACOL_RS00790 ]
- pan locus tag?: SAUPAN001008000
- symbol: SACOL0156
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0156 [new locus tag: SACOL_RS00790 ]
- symbol: SACOL0156
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 174335..174538
- length: 204
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238709 NCBI
- RefSeq: YP_185056 NCBI
- BioCyc:
- MicrobesOnline: 911633 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGGATAAAGAATCTGTCGTAGCAAGTTTAGCTAGAAACAAAAAGATTGCTGTAGAAACA
ATGGCCGGTCAAAGGTACATCATAGAACGCATTTTACATACAAATGATGAAAAACATATT
CATATTTTGAAACCTAAAGATGTCGTGTTAGATGTAGATAGCATCAAAGAAATTGACGAA
AATCATTTAAATGATGCAACATAA60
120
180
204
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0156 [new locus tag: SACOL_RS00790 ]
- symbol: SACOL0156
- description: hypothetical protein
- length: 67
- theoretical pI: 6.08298
- theoretical MW: 7662.71
- GRAVY: -0.468657
⊟Function[edit | edit source]
- TIGRFAM: Energy metabolism Amino acids and amines quinohemoprotein amine dehydrogenase, alpha subunit (TIGR03908; EC 1.4.-.-; HMM-score: 13.1)
- TheSEED: FIG01108246: hypothetical protein
- PFAM:
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.002531
- TAT(Tat/SPI): 0.000303
- LIPO(Sec/SPII): 0.000631
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MDKESVVASLARNKKIAVETMAGQRYIIERILHTNDEKHIHILKPKDVVLDVDSIKEIDENHLNDAT
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlasquantitative data / protein copy number per cell: 145 [3]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- SACOL0156 no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: RpoF* (activation) regulon
RpoF (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation [4] other strains
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑
Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑
Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑
Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)
⊟Relevant publications[edit | edit source]