From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0253 [new locus tag: SACOL_RS01290 ]
  • pan locus tag?: SAUPAN001154000
  • symbol: rbsK
  • pan gene symbol?: rbsK
  • synonym:
  • product: ribokinase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0253 [new locus tag: SACOL_RS01290 ]
  • symbol: rbsK
  • product: ribokinase
  • replicon: chromosome
  • strand: -
  • coordinates: 293821..294735
  • length: 915
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGACCAACAAAGTTGTTATTTTAGGTTCAACGAATGTCGATCAATTTTTAACAGTTGAA
    AGATATGCACAACCAGGCGAAACATTACATGTTGAAGAAGCACAAAAAGCATTCGGCGGA
    GGTAAAGGTGCCAACCAGGCTATTGCCACTGCACGCATGCAAGCAGACACAACATTTATT
    ACTAAAATTGGCACTGATGGCGTTGCTGATTTCATCTTAGAAGATTTTAAAGTAGCTCAT
    ATTGATACATCATATATTATCAAAACAGCTGAAGCAAAAACGGGCCAAGCCTTTATCACT
    GTGAATGCAGAAGGACAAAACACCATCTATGTTTATGGTGGTGCGAATATGACGATGACA
    CCTGAAGATGTTATTAACGCAAAAGACGCTATAATCAATGCAGACTTTGTCGTTGCACAA
    TTAGAAGTACCCATCCCGGCTATTATATCTGCATTTGAAATTGCCAAGGCACATGGTGTG
    ACGACAGTATTAAATCCTGCACCAGCGAAAGCATTACCTAATGAATTATTATCATTAATC
    GATATTATTGTGCCAAACGAAACAGAAGCCGAATTGTTATCTGGGATTAAAGTAACTAAT
    GAACAATCTATGAAAGACAATGCCAATTACTTTTTATCTATAGGCATTAAGACTGTTTTG
    ATTACGCTAGGTAAGCAAGGTACATATTTTGCTACTAAAAATCAAAGCCAACACATCGAA
    GCTTATAAAGTAAATGCGATTGATACAACTGCTGCAGGCGACACATTTATTGGTGCATTT
    GTCAGTCGCTTAAACAAGTCGCAAGATAACTTAGCAGATGCTATTGATTTTGGTAATAAA
    GCGAGCTCACTCACTGTACAAAAACACGGCGCGCAAGCATCTATTCCTCTACTAGAAGAA
    GTAAATCAAGTTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    915

Protein[edit | edit source]

Protein Data Bank: 3RY7

General[edit | edit source]

  • locus tag: SACOL0253 [new locus tag: SACOL_RS01290 ]
  • symbol: RbsK
  • description: ribokinase
  • length: 304
  • theoretical pI: 4.6011
  • theoretical MW: 32448.5
  • GRAVY: 0.0286184

Function[edit | edit source]

  • reaction:
    EC 2.7.1.15?  ExPASy
    Ribokinase ATP + D-ribose = ADP + D-ribose 5-phosphate
  • TIGRFAM:
    Metabolism Energy metabolism Sugars ribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 379.2)
    and 7 more
    Metabolism Energy metabolism Sugars 5-dehydro-2-deoxygluconokinase (TIGR04382; EC 2.7.1.92; HMM-score: 114.7)
    hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 91.2)
    1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 83.3)
    Cell structure Cell envelope Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides bifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 80.6)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Thiamine hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase (TIGR00097; EC 2.7.1.49,2.7.4.7; HMM-score: 50.7)
    Metabolism Energy metabolism Biosynthesis and degradation of polysaccharides tagatose-6-phosphate kinase (TIGR01231; EC 2.7.1.144; HMM-score: 25.9)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxal kinase (TIGR00687; EC 2.7.1.35; HMM-score: 25.1)
  • TheSEED:  
    Carbohydrates Monosaccharides D-ribose utilization  Ribokinase (EC 2.7.1.15)
    and 1 more
    Deoxyribose and Deoxynucleoside Catabolism  Ribokinase (EC 2.7.1.15)
  • PFAM:
    Ribokinase (CL0118) PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 227.8)
    and 3 more
    Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 49.9)
    NADP_Rossmann (CL0063) Glyco_hydro_4; Family 4 glycosyl hydrolase (PF02056; HMM-score: 14.2)
    Ig (CL0011) Adeno_E3_CR1; Adenovirus E3 region protein CR1 (PF02440; HMM-score: 11.7)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014499
    • TAT(Tat/SPI): 0.001126
    • LIPO(Sec/SPII): 0.001169
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTNKVVILGSTNVDQFLTVERYAQPGETLHVEEAQKAFGGGKGANQAIATARMQADTTFITKIGTDGVADFILEDFKVAHIDTSYIIKTAEAKTGQAFITVNAEGQNTIYVYGGANMTMTPEDVINAKDAIINADFVVAQLEVPIPAIISAFEIAKAHGVTTVLNPAPAKALPNELLSLIDIIVPNETEAELLSGIKVTNEQSMKDNANYFLSIGIKTVLITLGKQGTYFATKNQSQHIEAYKVNAIDTTAAGDTFIGAFVSRLNKSQDNLADAIDFGNKASSLTVQKHGAQASIPLLEEVNQV

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise  

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]

Jing Li, Chengliang Wang, Yejuan Wu, Minhao Wu, Lin Wang, Yang Wang, Jianye Zang
Crystal structure of Sa239 reveals the structural basis for the activation of ribokinase by monovalent cations.
J Struct Biol: 2012, 177(2);578-82
[PubMed:22198595] [WorldCat.org] [DOI] (I p)