From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
  • pan locus tag?: SAUPAN001177000
  • symbol: SACOL0273
  • pan gene symbol?: essA
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
  • symbol: SACOL0273
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 313250..313708
  • length: 459
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTGATGAATAGCGTGATTGCTTTAACTTTTTTAACAGCATCTAGCAATAATGGCGGA
    CTTAATATTGATGTGCAACAAGAAGAGGAAAAGCGAATCAATAATGATTTAAATCAATAT
    GATACAACGCTATTTAATAAAGACAGCAAAGCGGTTAATGATGCGATTGCTAAGCAGAAA
    AAAGAACGACAACAACAAATAAAAAATGATATGTTTCAAAATCAAGCGAGTCACTCGACT
    CGCTTGAATGAAACTAAAAAAGTGTTATTTTCCAAATCTAACTTAGAAAAGACTTCGGAG
    AGTGATAAAAGCCCCTATATTCAAAACAAGCAGGAGAAAAAAATATTCCCGTACATTTTG
    ATGTCTGTAGGGGCTTTTTTGACTTTAGGATTTGTCATTTTTTCAATTCATAAAGGGAGA
    CGAACGAAAAATGAATCAGCACGTAAAAGTAACATTTGA
    60
    120
    180
    240
    300
    360
    420
    459


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
  • symbol: SACOL0273
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 10.3846
  • theoretical MW: 17392.6
  • GRAVY: -0.768421

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 113.3)
  • TheSEED  :
    • Putative secretion system component EssA
    Membrane Transport Protein secretion system, Type VII ESAT-6 proteins secretion system in Firmicutes  Putative secretion system component EssA
  • PFAM:
    no clan defined EssA; WXG100 protein secretion system (Wss), protein EssA (PF10661; HMM-score: 28.4)
    and 5 more
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 20.9)
    YrhC; YrhC-like protein (PF14143; HMM-score: 14.4)
    NEDD4_Bsd2; NEDD4/Bsd2 (PF10176; HMM-score: 13.9)
    HTH (CL0123) NFRKB_winged; NFRKB Winged Helix-like (PF14465; HMM-score: 13.8)
    Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0002
    • Cytoplasmic Membrane Score: 0.9563
    • Cell wall & surface Score: 0.0055
    • Extracellular Score: 0.0379
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.095756
    • TAT(Tat/SPI): 0.001748
    • LIPO(Sec/SPII): 0.319717
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Integral membrane [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]