Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
- pan locus tag?: SAUPAN001177000
- symbol: SACOL0273
- pan gene symbol?: essA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
- symbol: SACOL0273
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 313250..313708
- length: 459
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236661 NCBI
- RefSeq: YP_185168 NCBI
- BioCyc: see SACOL_RS01385
- MicrobesOnline: 911746 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGTTGATGAATAGCGTGATTGCTTTAACTTTTTTAACAGCATCTAGCAATAATGGCGGA
CTTAATATTGATGTGCAACAAGAAGAGGAAAAGCGAATCAATAATGATTTAAATCAATAT
GATACAACGCTATTTAATAAAGACAGCAAAGCGGTTAATGATGCGATTGCTAAGCAGAAA
AAAGAACGACAACAACAAATAAAAAATGATATGTTTCAAAATCAAGCGAGTCACTCGACT
CGCTTGAATGAAACTAAAAAAGTGTTATTTTCCAAATCTAACTTAGAAAAGACTTCGGAG
AGTGATAAAAGCCCCTATATTCAAAACAAGCAGGAGAAAAAAATATTCCCGTACATTTTG
ATGTCTGTAGGGGCTTTTTTGACTTTAGGATTTGTCATTTTTTCAATTCATAAAGGGAGA
CGAACGAAAAATGAATCAGCACGTAAAAGTAACATTTGA60
120
180
240
300
360
420
459
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0273 [new locus tag: SACOL_RS01385 ]
- symbol: SACOL0273
- description: hypothetical protein
- length: 152
- theoretical pI: 10.3846
- theoretical MW: 17392.6
- GRAVY: -0.768421
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 113.3)
- TheSEED :
- Putative secretion system component EssA
- PFAM: no clan defined EssA; WXG100 protein secretion system (Wss), protein EssA (PF10661; HMM-score: 28.4)and 5 moreDUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 20.9)YrhC; YrhC-like protein (PF14143; HMM-score: 14.4)NEDD4_Bsd2; NEDD4/Bsd2 (PF10176; HMM-score: 13.9)HTH (CL0123) NFRKB_winged; NFRKB Winged Helix-like (PF14465; HMM-score: 13.8)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.9563
- Cell wall & surface Score: 0.0055
- Extracellular Score: 0.0379
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0
- Signal peptide possibility: 0
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.095756
- TAT(Tat/SPI): 0.001748
- LIPO(Sec/SPII): 0.319717
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLMNSVIALTFLTASSNNGGLNIDVQQEEEKRINNDLNQYDTTLFNKDSKAVNDAIAKQKKERQQQIKNDMFQNQASHSTRLNETKKVLFSKSNLEKTSESDKSPYIQNKQEKKIFPYILMSVGAFLTLGFVIFSIHKGRRTKNESARKSNI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization: Integral membrane [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)