From AureoWiki
Jump to navigation Jump to search
Pangenome04-0298108BA0217611819-97685071193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
  • pan locus tag?: SAUPAN001579000
  • symbol: SACOL0359
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
  • symbol: SACOL0359
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 371768..371962
  • length: 195
  • essential: unknown

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGACGGAAGTTAAAATTAAAACTATTTCAGGCGGAGTTTATTTTGTAAAAACGGCTGAA
    CCTTTTGAAAAATATGTTGAAAGAATGACGAGTTTTAATGGTTATATTTACGCAAGTACT
    ATAATCAAGAAACCAACGTATATTAAAACAGATACGATTGAATCAATCACACTTATTGAG
    GAGCATGGGAAATGA
    60
    120
    180
    195

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0359 [new locus tag: SACOL_RS01805 ]
  • symbol: SACOL0359
  • description: hypothetical protein
  • length: 64
  • theoretical pI: 8.85701
  • theoretical MW: 7340.46
  • GRAVY: -0.223438

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Hypothetical protein, SAV0878 homolog [SA bacteriophages 11, Mu50B]
  • PFAM:

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009743
    • TAT(Tat/SPI): 0.000421
    • LIPO(Sec/SPII): 0.002101
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTEVKIKTISGGVYFVKTAEPFEKYVERMTSFNGYIYASTIIKKPTYIKTDTIESITLIEEHGK

Experimental data[edit | edit source]

  • experimental localization: Cytoplasmic [1] [2]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]