From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
  • pan locus tag?: SAUPAN001890000
  • symbol: SACOL0418
  • pan gene symbol?: tatA
  • synonym:
  • product: mttA/Hcf106 family protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
  • symbol: SACOL0418
  • product: mttA/Hcf106 family protein
  • replicon: chromosome
  • strand: -
  • coordinates: 424528..424743
  • length: 216
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTCGTCATTAGC
    ATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGTGCCATCGGT
    TCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCTCACGATACA
    CCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG
    60
    120
    180
    216

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0418 [new locus tag: SACOL_RS02105 ]
  • symbol: SACOL0418
  • description: mttA/Hcf106 family protein
  • length: 71
  • theoretical pI: 9.23936
  • theoretical MW: 7801.96
  • GRAVY: -0.192958

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 68)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.4)
  • TheSEED  :
    • Twin-arginine translocation protein TatA
    Membrane Transport Protein translocation across cytoplasmic membrane Twin-arginine translocation system  Twin-arginine translocation protein TatA
  • PFAM:
    no clan defined MttA_Hcf106; mttA/Hcf106 family (PF02416; HMM-score: 68.7)
    and 1 more
    DUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.17
    • Cytoplasmic Membrane Score: 9.51
    • Cellwall Score: 0.16
    • Extracellular Score: 0.15
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.116733
    • TAT(Tat/SPI): 0.001642
    • LIPO(Sec/SPII): 0.005787
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ

Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: Fur* (repression) regulon
    Fur*(TF)important in Iron homeostasis; RegPrecise 

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]