Jump to navigation
Jump to search
NCBI: 06-JUL-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus Newman
- locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
- pan locus tag?: SAUPAN001890000
- symbol: tatA
- pan gene symbol?: tatA
- synonym:
- product: twin-arginine translocation protein TatA
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
- symbol: tatA
- product: twin-arginine translocation protein TatA
- replicon: chromosome
- strand: -
- coordinates: 390202..390417
- length: 216
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 5330179 NCBI
- RefSeq: YP_001331374 NCBI
- BioCyc:
- MicrobesOnline: 3705871 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATAACTAACACTTTTATTTTAGGCATCACAGGCCCAACAAGTCTTGTCGTCATTAGC
ATTATCGCTTTAATTATTTTTGGTCCGAAAAAATTACCACAATTTGGCCGTGCCATCGGT
TCTACTTTAAAAGAATTTAAATCTGCAACAGAAGATTTAGATAAAGAGTCTCACGATACA
CCCAGTAAGGAATCGAAACAACAGCGAGAGCAATAG60
120
180
216
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: NWMN_0340 [new locus tag: NWMN_RS01925 ]
- symbol: TatA
- description: twin-arginine translocation protein TatA
- length: 71
- theoretical pI: 9.23936
- theoretical MW: 7801.96
- GRAVY: -0.192958
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase, TatA/E family (TIGR01411; HMM-score: 68)and 1 moreProtein fate Protein and peptide secretion and trafficking twin arginine-targeting protein translocase TatB (TIGR01410; HMM-score: 34.4)
- TheSEED: Clustering-based subsystems proteosome related Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related Twin-arginine translocation protein TatAand 1 more
- PFAM: no clan defined MttA_Hcf106; mttA/Hcf106 family (PF02416; HMM-score: 68.7)and 1 moreDUF1510; Protein of unknown function (DUF1510) (PF07423; HMM-score: 13.8)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.17
- Cytoplasmic Membrane Score: 9.51
- Cellwall Score: 0.16
- Extracellular Score: 0.15
- Internal Helix: 1
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 2
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.116733
- TAT(Tat/SPI): 0.001642
- LIPO(Sec/SPII): 0.005787
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MITNTFILGITGPTSLVVISIIALIIFGPKKLPQFGRAIGSTLKEFKSATEDLDKESHDTPSKESKQQREQ
⊟Experimental data[edit | edit source]
- experimentally validated: no data available
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: Fur* (repression) regulon
Fur (TF) important in Iron homeostasis; RegPrecise
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
⊟Relevant publications[edit | edit source]