From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0438 [new locus tag: SACOL_RS02205 ]
  • pan locus tag?: SAUPAN001915000
  • symbol: ssb2
  • pan gene symbol?: ssb
  • synonym:
  • product: single-stranded DNA-binding protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0438 [new locus tag: SACOL_RS02205 ]
  • symbol: ssb2
  • product: single-stranded DNA-binding protein
  • replicon: chromosome
  • strand: +
  • coordinates: 443011..443514
  • length: 504
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGCTAAATAGAGTTGTATTAGTAGGTCGTTTAACGAAAGATCCGGAATACAGAACCACT
    CCCTCAGGTGTGAGTGTAGCGACATTCACTCTTGCAGTAAATCGTACGTTCACGAATGCT
    CAAGGGGAGCGCGAAGCAGATTTTATTAACTGTGTTGTTTTTAGAAGACAAGCAGATAAT
    GTAAATAACTATTTATCTAAAGGTAGTTTAGCTGGTGTAGATGGTCGCTTACAATCCCGT
    AATTATGAAAATCAAGAAGGTCGTCGTGTGTTTGTTACTGAAGTTGTGTGTGATAGCGTT
    CAATTCCTTGAACCTAAAAATGCGCAACAAAATGGTGGCCAACGTCAACAAAATGAATTC
    CAAGATTACGGTCAAGGATTCGGTGGTCAACAATCAGGACAAAACAATTCGTACAATAAT
    TCATCAAACACGAAACAATCTGATAATCCATTTGCAAATGCAAACGGACCGATTGATATA
    AGTGATGATGACTTACCATTCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    504


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL0438 [new locus tag: SACOL_RS02205 ]
  • symbol: Ssb2
  • description: single-stranded DNA-binding protein
  • length: 167
  • theoretical pI: 4.73083
  • theoretical MW: 18539
  • GRAVY: -0.828144

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing DNA metabolism DNA replication, recombination, and repair single-stranded DNA-binding protein (TIGR00621; HMM-score: 163)
    and 2 more
    Genetic information processing DNA metabolism DNA replication, recombination, and repair primosomal replication protein PriB (TIGR04418; HMM-score: 33.9)
    heme uptake protein IsdC (TIGR03656; HMM-score: 11)
  • TheSEED  :
    • Phage ssDNA binding protein
    DNA Metabolism DNA repair DNA repair, bacterial  Single-stranded DNA-binding protein
    and 2 more
    DNA Metabolism DNA repair DNA repair, bacterial RecFOR pathway  Single-stranded DNA-binding protein
    DNA Metabolism DNA repair DNA repair, bacterial UmuCD system  Single-stranded DNA-binding protein
  • PFAM:
    OB (CL0021) SSB; Single-strand binding protein family (PF00436; HMM-score: 129.5)
    and 2 more
    SSB_1; Another single-strand binding protein family (PF22657; HMM-score: 27.6)
    tRNA_anti-codon; OB-fold nucleic acid binding domain (PF01336; HMM-score: 18.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.67
    • Cytoplasmic Membrane Score: 0.01
    • Cellwall Score: 0.15
    • Extracellular Score: 0.17
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8862
    • Cytoplasmic Membrane Score: 0.0047
    • Cell wall & surface Score: 0.0004
    • Extracellular Score: 0.1088
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.063451
    • TAT(Tat/SPI): 0.005185
    • LIPO(Sec/SPII): 0.005625
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MLNRVVLVGRLTKDPEYRTTPSGVSVATFTLAVNRTFTNAQGEREADFINCVVFRRQADNVNNYLSKGSLAGVDGRLQSRNYENQEGRRVFVTEVVCDSVQFLEPKNAQQNGGQRQQNEFQDYGQGFGGQQSGQNNSYNNSSNTKQSDNPFANANGPIDISDDDLPF

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3] [4]
  • quantitative data / protein copy number per cell: 360 [5]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • data available for JSNZ

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 22.34 h [6]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]