Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0466 [new locus tag: SACOL_RS02360 ]
- pan locus tag?: SAUPAN002101000
- symbol: SACOL0466
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0466 [new locus tag: SACOL_RS02360 ]
- symbol: SACOL0466
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 468662..469021
- length: 360
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236793 NCBI
- RefSeq: YP_185356 NCBI
- BioCyc: see SACOL_RS02360
- MicrobesOnline: 911936 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGAATATCATCTCAACAATTTTAATCATATTTGTGGCATTAGAGTTTTTCTATATTATG
TACCTTGAAACGATTGCTACAACTTCCAAAAAGACTAGCGAGACATTTAATATAAGCGTC
GATAAATTGAAAGACAAAAATATTAACCTACTTTTGAAGAACCAAGGCGTATATAACGGT
TTAATCGGAGTTTTGCTAATATACGGTTTGTTTATCAGCAGTAATCCAAAAGAAATATGC
GCAGCTATTTTAGTGTATATCATTGGCGTTGCTATTTATGGTGGCCTTTCAAGCAATATT
AGTATCTTTTTCAAACAAGGCACATTGCCAGTATTGGCACTCATATCAATGCTTTGGTAA60
120
180
240
300
360
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0466 [new locus tag: SACOL_RS02360 ]
- symbol: SACOL0466
- description: hypothetical protein
- length: 119
- theoretical pI: 8.98034
- theoretical MW: 13187.7
- GRAVY: 0.902521
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED :
- FIG01107866: hypothetical protein
- PFAM: Hypoth_1 (CL0447) DUF1304; Protein of unknown function (DUF1304) (PF06993; HMM-score: 107.1)and 2 morePDDEXK (CL0236) RecU; Recombination protein U (PF03838; HMM-score: 13.3)no clan defined PsiE; Phosphate-starvation-inducible E family (PF06146; HMM-score: 13.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.987
- Cell wall & surface Score: 0
- Extracellular Score: 0.0129
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.105176
- TAT(Tat/SPI): 0.000393
- LIPO(Sec/SPII): 0.046972
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNIISTILIIFVALEFFYIMYLETIATTSKKTSETFNISVDKLKDKNINLLLKNQGVYNGLIGVLLIYGLFISSNPKEICAAILVYIIGVAIYGGLSSNISIFFKQGTLPVLALISMLW
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Integral membrane [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)