Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0680 [new locus tag: SACOL_RS03505 ]
- pan locus tag?: SAUPAN002495000
- symbol: SACOL0680
- pan gene symbol?: mnhB2
- synonym:
- product: monovalent cation/H+ antiporter subunit B
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0680 [new locus tag: SACOL_RS03505 ]
- symbol: SACOL0680
- product: monovalent cation/H+ antiporter subunit B
- replicon: chromosome
- strand: +
- coordinates: 705993..706418
- length: 426
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237831 NCBI
- RefSeq: YP_185563 NCBI
- BioCyc: see SACOL_RS03505
- MicrobesOnline: 912159 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAAAGAGAATGATGTCGTGTTAAGAACGGTCACGAAACTTGTTGTATTTATTTTATTG
ACTTTCGGATTCTATGTCTTCTTCGCAGGTCATAATAATCCTGGTGGTGGGTTTATTGGT
GGTTTAATATTTAGTTCAGCGTTTATTTTAATGTTTCTGGCTTTTAATGTTGAAGAGGTT
TTAGAAAGTTTACCGATTGATTTTAGAATTTTAATGATTATTGGAGCATTGGTATCATCT
ATTACTGCGATAATACCTATGTTTTTTGGAAAACCATTTTTGTCTCAATATGAAACAACT
TGGATACTTCCAATTTTAGGACAAATTCATGTAAGTACAATAACACTTTTTGAATTAGGT
ATTTTATTCTCAGTTGTTGGTGTTATTGTCACAGTGATGTTGTCGCTTAGCGGAGGTCGA
TCATGA60
120
180
240
300
360
420
426
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0680 [new locus tag: SACOL_RS03505 ]
- symbol: SACOL0680
- description: monovalent cation/H+ antiporter subunit B
- length: 141
- theoretical pI: 5.6084
- theoretical MW: 15454.4
- GRAVY: 1.15035
⊟Function[edit | edit source]
- TIGRFAM: Transport and binding proteins Cations and iron carrying compounds monovalent cation:proton antiporter (TIGR00943; HMM-score: 103.6)
- TheSEED :
- Na(+) H(+) antiporter subunit B (TC 2.A.63.1.3)
- PFAM: no clan defined MnhB; Domain related to MnhB subunit of Na+/H+ antiporter (PF04039; HMM-score: 117.6)and 3 moreHyr1; Hyphally regulated cell wall GPI-anchored protein 1 (PF15789; HMM-score: 11.8)DUF3493; Low psii accumulation1 / Rep27 (PF11998; HMM-score: 7.8)Cupin (CL0029) POPDC1-3; POPDC1-3 (PF04831; HMM-score: 6.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 4
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0001
- Cytoplasmic Membrane Score: 0.9995
- Cell wall & surface Score: 0
- Extracellular Score: 0.0004
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.004138
- TAT(Tat/SPI): 0.000248
- LIPO(Sec/SPII): 0.008493
- predicted transmembrane helices (TMHMM): 4
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEVLESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELGILFSVVGVIVTVMLSLSGGRS
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: SACOL0678 > SACOL0679 > SACOL0680 > SACOL0681 > SACOL0682 > SACOL0684 > SACOL0685 > SACOL0686
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)