From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
  • pan locus tag?: SAUPAN002565000
  • symbol: SACOL0741
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
  • symbol: SACOL0741
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 762031..762489
  • length: 459
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    GTGACACATATTATTATTGATGGAGATGCTTGTCCTGTTGTTGATTCTATTATAGATTTA
    ACAACTGAGACAGGCATTTTTGTGACAATTATTCGGAGCTTCAGCCATTTTTCGAACCAA
    TTATATCCTCCACATGTATCAACATTATATGTTGATGATGGACCAGATGCAGTTGATTAC
    AAAATTGTTCAATTATCAACGAAGGATGATATCGTAGTCACTCAAGATTATGGACTCGCA
    AGTTTATTAGTCGACAAAGTCTTAATTGTCATGCATCATAATGGGAAGATATACAATTCC
    AAAAATATTCAACAACTATTAGATAAACGATATATGAATGCACAAATTAGAAAACAAGGT
    GGTCGCCACAAAGGTCCCCCACCTTTTACAAAGCAAGATCAAAAAGTGTTTGAACAATCA
    CTATTAAAAGTCATTCATCGAATTAAGGAGCTGGATTAA
    60
    120
    180
    240
    300
    360
    420
    459


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0741 [new locus tag: SACOL_RS03805 ]
  • symbol: SACOL0741
  • description: hypothetical protein
  • length: 152
  • theoretical pI: 7.23211
  • theoretical MW: 17257.7
  • GRAVY: -0.219079

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • FIG01108093: hypothetical protein
  • PFAM:
    PIN (CL0280) DUF188; Uncharacterized BCR, YaiI/YqxD family COG1671 (PF02639; HMM-score: 137.8)
    and 1 more
    NTN (CL0052) GATase_6; Glutamine amidotransferase domain (PF13522; HMM-score: 11.9)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9669
    • Cytoplasmic Membrane Score: 0.0298
    • Cell wall & surface Score: 0.0006
    • Extracellular Score: 0.0028
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001461
    • TAT(Tat/SPI): 0.000095
    • LIPO(Sec/SPII): 0.000234
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MTHIIIDGDACPVVDSIIDLTTETGIFVTIIRSFSHFSNQLYPPHVSTLYVDDGPDAVDYKIVQLSTKDDIVVTQDYGLASLLVDKVLIVMHHNGKIYNSKNIQQLLDKRYMNAQIRKQGGRHKGPPPFTKQDQKVFEQSLLKVIHRIKELD

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2]
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: SigB* (activation) regulon
    SigB*(sigma factor)controlling a large regulon involved in stress/starvation response and adaptation;  [3] [4]   other strains

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  2. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  3. Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
    Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
    J Bacteriol: 2004, 186(13);4085-99
    [PubMed:15205410] [WorldCat.org] [DOI] (P p)
  4. Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
    The sigmaB regulon in Staphylococcus aureus and its regulation.
    Int J Med Microbiol: 2006, 296(4-5);237-58
    [PubMed:16644280] [WorldCat.org] [DOI] (P p)

Relevant publications[edit | edit source]