From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL0791 [new locus tag: SACOL_RS04070 ]
  • pan locus tag?: SAUPAN002629000
  • symbol: nrdI
  • pan gene symbol?: nrdI
  • synonym:
  • product: ribonucleotide reductase stimulatory protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL0791 [new locus tag: SACOL_RS04070 ]
  • symbol: nrdI
  • product: ribonucleotide reductase stimulatory protein
  • replicon: chromosome
  • strand: +
  • coordinates: 815374..815772
  • length: 399
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAATAATATATTTTTCATTTACTGGAAATGTCCGTCGTTTTATTAAGAGAACAGAA
    CTTGAAAATACGCTTGAGATTACAGCAGAAAATTGTATGGAACCAGTTCATGAACCGTTT
    ATTATCGTTACTGGCACTATTGGATTTGGAGAAGTACCAGAACCCGTTCAATCTTTTTTA
    GAAGTTAATCATCAATACATCAGAGGTGTGGCAGCTAGCGGTAATCGAAATTGGGGACTA
    AATTTCGCAAAAGCGGGTCGCACGATATCAGAAGAGTATAATGTCCCTTTATTAATGAAG
    TTTGAGTTACATGGAAAAAACAAAGACGTTATTGAATTTAAGAACAAGGTGGGTAATTTT
    AATGAAAACCATGGAAGAGAAAAAGTACAATCATATTGA
    60
    120
    180
    240
    300
    360
    399

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL0791 [new locus tag: SACOL_RS04070 ]
  • symbol: NrdI
  • description: ribonucleotide reductase stimulatory protein
  • length: 132
  • theoretical pI: 7.67183
  • theoretical MW: 15166.2
  • GRAVY: -0.422727

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 115.3)
  • TheSEED:  
    Nucleosides and Nucleotides Nucleosides and Nucleotides - no subcategory Ribonucleotide reduction  Ribonucleotide reduction protein NrdI
  • PFAM:
    Flavoprotein (CL0042) Flavodoxin_NdrI; NrdI Flavodoxin like (PF07972; HMM-score: 118.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005252
    • TAT(Tat/SPI): 0.000118
    • LIPO(Sec/SPII): 0.001041
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNFNENHGREKVQSY

Experimental data[edit | edit source]

  • experimental localization: Cytoplasmic [1]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]