Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SA0685 [new locus tag: SA_RS03905 ]
- pan locus tag?: SAUPAN002629000
- symbol: nrdI
- pan gene symbol?: nrdI
- synonym:
- product: ribonucleotide reductase stimulatory protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SA0685 [new locus tag: SA_RS03905 ]
- symbol: nrdI
- product: ribonucleotide reductase stimulatory protein
- replicon: chromosome
- strand: +
- coordinates: 783110..783508
- length: 399
- essential: no DEG other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 1123492 NCBI
- RefSeq: NP_373940 NCBI
- BioCyc: see SA_RS03905
- MicrobesOnline: 102966 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361ATGAAAATAATATATTTTTCATTTACTGGAAATGTCCGTCGTTTTATTAAGAGAACAGAA
CTTGAAAATACGCTTGAGATTACAGCAGAAAATTGTATGGAACCAGTTCATGAACCGTTT
ATTATCGTTACTGGCACTATTGGATTTGGAGAAGTACCAGAACCCGTTCAATCTTTTTTA
GAAGTTAATCATCAATACATCAGAGGTGTGGCAGCTAGCGGTAATCGAAATTGGGGACTA
AATTTCGCAAAAGCGGGTCGCACGATATCAGAAGAGTATAATGTCCCTTTATTAATGAAG
TTTGAGTTACATGGAAAAAACAAAGACGTTATTGAATTTAAGAACAAGGTGGGTAATTTT
AATGAAAACCATGGAAGAGAAAAAGTACAATCATATTGA60
120
180
240
300
360
399
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SA0685 [new locus tag: SA_RS03905 ]
- symbol: NrdI
- description: ribonucleotide reductase stimulatory protein
- length: 132
- theoretical pI: 7.67183
- theoretical MW: 15166.2
- GRAVY: -0.422727
⊟Function[edit | edit source]
- TIGRFAM: Purines, pyrimidines, nucleosides, and nucleotides 2'-Deoxyribonucleotide metabolism nrdI protein (TIGR00333; HMM-score: 115.3)
- TheSEED :
- Ribonucleotide reduction protein NrdI
- PFAM: Flavoprotein (CL0042) Flavodoxin_NdrI; NrdI Flavodoxin like (PF07972; HMM-score: 126.1)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9903
- Cytoplasmic Membrane Score: 0.005
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0046
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005252
- TAT(Tat/SPI): 0.000118
- LIPO(Sec/SPII): 0.001041
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKIIYFSFTGNVRRFIKRTELENTLEITAENCMEPVHEPFIIVTGTIGFGEVPEPVQSFLEVNHQYIRGVAASGNRNWGLNFAKAGRTISEEYNVPLLMKFELHGKNKDVIEFKNKVGNFNENHGREKVQSY
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: data available for COL
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: nrdI > nrdE > nrdF
⊟Regulation[edit | edit source]
- regulator: NrdR (repression) regulon
NrdR (TF) important in Deoxyribonucleotide biosynthesis; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]