From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
  • pan locus tag?: SAUPAN003267000
  • symbol: qoxD
  • pan gene symbol?: qoxD
  • synonym:
  • product: quinol oxidase subunit IV

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
  • symbol: qoxD
  • product: quinol oxidase subunit IV
  • replicon: chromosome
  • strand: -
  • coordinates: 1076196..1076474
  • length: 279
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAAACATACTGTAGGATTTATCGCATCTATCGTATTAACGCTTTTAGCAGTTTACGTA
    ACACTATACACGTCATTAACATTCCACGCGAAGTTGACAATTATCTTTGGCTTTGCATTC
    GTCCAAGCAGGACTTCAATTATTAATGTTCATGCATTTAACTGAAGGTAAAGATGGACGT
    TTACAAACATTCAAAGTTATCTTTGCTCTTGTAATTACACTTTGTTTCGTTGTCGGAACA
    TATTGGGTTATGCAAGGCGGTCACTCTTCACACTTATAA
    60
    120
    180
    240
    279


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1067 [new locus tag: SACOL_RS05440 ]
  • symbol: QoxD
  • description: quinol oxidase subunit IV
  • length: 92
  • theoretical pI: 9.69391
  • theoretical MW: 10254.3
  • GRAVY: 1.01087

⊟Function[edit | edit source]

  • reaction:
    EC 1.9.3.-?  ExPASy
    EC 1.10.3.-?  ExPASy
    2 a quinol + O2 = 2 a quinone + 2 H2O?
  • TIGRFAM:
    Metabolism Energy metabolism Electron transport cytochrome aa3 quinol oxidase, subunit IV (TIGR02901; EC 1.10.3.-; HMM-score: 104)
    and 3 more
    Metabolism Energy metabolism Electron transport cytochrome o ubiquinol oxidase subunit IV (TIGR02847; EC 1.10.3.-; HMM-score: 55.7)
    Metabolism Energy metabolism Electron transport caa(3)-type oxidase, subunit IV (TIGR02229; HMM-score: 17.7)
    Metabolism Energy metabolism Electron transport cytochrome c oxidase, subunit IVB (TIGR02908; EC 1.9.3.1; HMM-score: 14.6)
  • TheSEED  :
    • AA3-600 quinol oxidase subunit IV
    Respiration Electron accepting reactions Terminal cytochrome C oxidases  quinol oxidase polypeptide IV QoxD (EC:1.9.3.-)
  • PFAM:
    no clan defined COX4_pro; Prokaryotic Cytochrome C oxidase subunit IV (PF03626; HMM-score: 47)
    and 4 more
    MtN3-like (CL0141) MtN3_slv; Sugar efflux transporter for intercellular exchange (PF03083; HMM-score: 14.5)
    Rhomboid-like (CL0207) Rhomboid; Rhomboid family (PF01694; HMM-score: 14)
    no clan defined DUF5654; Family of unknown function (DUF5654) (PF18898; HMM-score: 10.1)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 7.4)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 3
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0002
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.014241
    • TAT(Tat/SPI): 0.000346
    • LIPO(Sec/SPII): 0.004461
  • predicted transmembrane helices (TMHMM): 3

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLTIIFGFAFVQAGLQLLMFMHLTEGKDGRLQTFKVIFALVITLCFVVGTYWVMQGGHSSHL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: Integral membrane [1]
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

⊟Relevant publications[edit | edit source]