From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1117 [new locus tag: SACOL_RS05705 ]
  • pan locus tag?: SAUPAN003335000
  • symbol: SACOL1117
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1117 [new locus tag: SACOL_RS05705 ]
  • symbol: SACOL1117
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1127032..1127223
  • length: 192
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGAAACAAAAAAAATCTAAAAATATCTTTTGGGTATTTTCTATATTAGCTGTTGTTTTC
    TTAGTATTATTTAGTTTTGCTGTTGGTGCATCAAATGTACCAATGATGATTTTAACATTT
    ATATTACTCGTTGCAACCTTTGGAATTGGATTTACTACAAAGAAAAAATATCGAGAAAAC
    GATTGGCTATAA
    60
    120
    180
    192

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL1117 [new locus tag: SACOL_RS05705 ]
  • symbol: SACOL1117
  • description: hypothetical protein
  • length: 63
  • theoretical pI: 10.9505
  • theoretical MW: 7249.77
  • GRAVY: 0.779365

⊟Function[edit | edit source]

  • TIGRFAM:
    early transcribed membrane protein (ETRAMP) family (TIGR01495; HMM-score: 14.6)
    Cell structure Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 12.7)
    cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.5)
    and 1 more
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 6.5)
  • TheSEED  :
    • FIG01107843: hypothetical protein
  • PFAM:
    no clan defined DUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 47)
    and 11 more
    DUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 18.1)
    DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 15.5)
    ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 14.9)
    DUF6442; Family of unknown function (DUF6442) (PF20040; HMM-score: 14.2)
    DUF5392; Family of unknown function (DUF5392) (PF17370; HMM-score: 14)
    DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13.3)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 12.5)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 12.1)
    DUF6520; Family of unknown function (DUF6520) (PF20130; HMM-score: 10.7)
    SNARE-fusion (CL0445) SNARE; SNARE domain (PF05739; HMM-score: 10.1)
    no clan defined DUF6480; Family of unknown function (DUF6480) (PF20088; HMM-score: 7.2)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0001
    • Cytoplasmic Membrane Score: 0.941
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0588
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.078075
    • TAT(Tat/SPI): 0.005197
    • LIPO(Sec/SPII): 0.052512
  • predicted transmembrane helices (TMHMM): 2

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL1117&oldid=88761"