Jump to navigation
Jump to search
NCBI: 26-AUG-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus N315
- locus tag: SAS031 [new locus tag: SA_RS05425 ]
- pan locus tag?: SAUPAN003335000
- symbol: SAS031
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SAS031 [new locus tag: SA_RS05425 ]
- symbol: SAS031
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 1085801..1085992
- length: 192
- essential: no DEG
⊟Accession numbers[edit | edit source]
- Gene ID: 1123783 NCBI
- RefSeq: NP_374226 NCBI
- BioCyc: see SA_RS05425
- MicrobesOnline: 103252 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGAAACAAAAAAAATCTAAAAATATCTTTTGGGTATTTTCTATATTAGCTGTTGTTTTC
TTAGTATTATTTAGTTTTGCTGTTGGTGCATCAAATGTACCAATGATGATTTTAACATTT
ATATTACTCGTTGCAACCTTTGGAATTGGATTTACTACAAAGAAAAAATATCGAGAAAAC
GATTGGCTATAA60
120
180
192
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SAS031 [new locus tag: SA_RS05425 ]
- symbol: SAS031
- description: hypothetical protein
- length: 63
- theoretical pI: 10.9505
- theoretical MW: 7249.77
- GRAVY: 0.779365
⊟Function[edit | edit source]
- TIGRFAM: early transcribed membrane protein (ETRAMP) family (TIGR01495; HMM-score: 14.6)Cell envelope Other LPXTG cell wall anchor domain (TIGR01167; HMM-score: 12.7)cxxc_20_cxxc protein (TIGR04104; HMM-score: 12.5)and 1 moreProtein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 6.5)
- TheSEED :
- FIG01107843: hypothetical protein
- PFAM: no clan defined DUF5325; Family of unknown function (DUF5325) (PF17259; HMM-score: 72.2)and 14 moreDUF3792; Protein of unknown function (DUF3792) (PF12670; HMM-score: 18.8)DUF4231; Protein of unknown function (DUF4231) (PF14015; HMM-score: 17)DUF4181; Domain of unknown function (DUF4181) (PF13789; HMM-score: 16.6)DUF4133; Domain of unknown function (DUF4133) (PF13571; HMM-score: 14.8)DUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 14.1)DUF5392; Family of unknown function (DUF5392) (PF17370; HMM-score: 14)Hypoth_1 (CL0447) DUF3784; Domain of unknown function (DUF3784) (PF12650; HMM-score: 13.5)no clan defined DUF3754; Protein of unknown function (DUF3754) (PF12576; HMM-score: 13.1)DUF4131; Domain of unknown function (DUF4131) (PF13567; HMM-score: 13)ETRAMP; Malarial early transcribed membrane protein (ETRAMP) (PF09716; HMM-score: 12.9)PHO4; Phosphate transporter family (PF01384; HMM-score: 11.8)PBP_N; Penicillin-binding protein N-terminus (PF17093; HMM-score: 11.6)SNARE; SNARE domain (PF05739; HMM-score: 10.2)Halogen_Hydrol; 5-bromo-4-chloroindolyl phosphate hydrolysis protein (PF10112; HMM-score: 8.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: 0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.078075
- TAT(Tat/SPI): 0.005197
- LIPO(Sec/SPII): 0.052512
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKQKKSKNIFWVFSILAVVFLVLFSFAVGASNVPMMILTFILLVATFGIGFTTKKKYRENDWL
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.