From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1280 [new locus tag: SACOL_RS06535 ]
  • pan locus tag?: SAUPAN003562000
  • symbol: cdsA
  • pan gene symbol?: cdsA
  • synonym:
  • product: phosphatidate cytidylyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1280 [new locus tag: SACOL_RS06535 ]
  • symbol: cdsA
  • product: phosphatidate cytidylyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 1289007..1289789
  • length: 783
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAGTTAGAACGCTGACAGCTATTATTGCCTTAATCGTATTCTTGCCTATCTTGTTA
    AAAGGCGGCCTTGTGTTAATGATATTTGCTAATATATTAGCATTGATTGCATTAAAAGAA
    TTGTTGAATATGAATATGATTAAATTTGTTTCAGTTCCTGGTTTAATTAGTGCAGTTGGT
    CTTATCATCATTATGTTGCCACAACATGCAGGGCCATGGGTACAAGTAATTCAATTAAAA
    AGTTTAATTGCAATGAGCTTTATTGTATTAAGTTATACTGTCTTATCTAAAAACAGATTT
    AGTTTTATGGATGCTGCATTTTGCTTAATGTCTGTGGCTTATGTAGGCATTGGTTTTATG
    TTCTTTTATGAAACGAGATCAGAAGGATTACATTACATATTATATGCCTTTTTAATTGTT
    TGGCTTACAGATACAGGGGCTTACTTGTTTGGTAAAATGATGGGTAAACATAAGCTTTGG
    CCAGTAATAAGTCCGAATAAAACAATCGAAGGATTCATAGGTGGCTTGTTCTGTAGTTTG
    ATAGTACCACTTGCAATGTTATATTTTGTAGATTTCAATATGAATGTATGGATATTACTT
    GGAGTGACATTGATTTTAAGTTTATTTGGTCAATTAGGTGATTTAGTGGAATCAGGATTT
    AAGCGTCATTTCGGCGTTAAAGACTCAGGTCGAATACTACCTGGACACGGTGGTATTTTA
    GACCGATTTGACAGCTTTATGTTTGTGTTACCATTATTAAATATTTTATTAATACAATCT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    783

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1280 [new locus tag: SACOL_RS06535 ]
  • symbol: CdsA
  • description: phosphatidate cytidylyltransferase
  • length: 260
  • theoretical pI: 9.75357
  • theoretical MW: 28964.1
  • GRAVY: 1.03

Function[edit | edit source]

  • reaction:
    EC 2.7.7.41?  ExPASy
    Phosphatidate cytidylyltransferase CTP + phosphatidate = diphosphate + CDP-diacylglycerol
  • TIGRFAM:
  • TheSEED:  
    Fatty Acids, Lipids, and Isoprenoids Phospholipids Glycerolipid and Glycerophospholipid Metabolism in Bacteria  Phosphatidate cytidylyltransferase (EC 2.7.7.41)
    and 1 more
    Miscellaneous Plant-Prokaryote comparative genomics IojapClusters  Phosphatidate cytidylyltransferase (EC 2.7.7.41)
  • PFAM:
    CTPT (CL0234) CTP_transf_1; Cytidylyltransferase family (PF01148; HMM-score: 249)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 10
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 8
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: 0
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.005451
    • TAT(Tat/SPI): 0.000113
    • LIPO(Sec/SPII): 0.01575
  • predicted transmembrane helices (TMHMM): 7

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVGLIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFMFFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSLIVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGILDRFDSFMFVLPLLNILLIQS

Experimental data[edit | edit source]

  • experimental localization: Integral membrane [1]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]