Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1404 [new locus tag: SACOL_RS07145 ]
- pan locus tag?: SAUPAN003763000
- symbol: trpG
- pan gene symbol?: trpG
- synonym:
- product: anthranilate synthase component II
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1404 [new locus tag: SACOL_RS07145 ]
- symbol: trpG
- product: anthranilate synthase component II
- replicon: chromosome
- strand: +
- coordinates: 1415613..1416179
- length: 567
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236143 NCBI
- RefSeq: YP_186256 NCBI
- BioCyc: see SACOL_RS07145
- MicrobesOnline: 912862 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541ATGATCTTAGTTGTAGATAATTATGATTCCTTTACATATAACCTAGTGGATATTGTTGCT
CAACATACTGACGTCATTGTTCAATACCCTGATGATGATAATGTGCTGAATCAATCGGTG
GACGCTGTTATTATATCTCCTGGTCCAGGGCATCCATTAGACGATCAACAGTTAATGAAA
ATCATATCAACCTATCAACACAAACCCATTTTAGGTATTTGTTTAGGGGCTCAGGCACTG
ACTTGTTACTACGGTGGAGAAGTCATTAAAGGCGACAAGGTTATGCACGGCAAAGTTGAT
ACACTAAAGGTTATATCGCATCATCAACATCTGTTATATCAAGATATACCAGAACAGTTT
TCAATTATGAGATATCATTCATTAATAAGTAACCCTGACAATTTTCCAGAAGAATTGAAA
ATTACTGGACGTACCAAAGATTGTATACAGTCATTCGAGCATAAAGAAAGACCGCATTAT
GGTATTCAGTACCATCCTGAATCATTTGCTACAGACTATGGTGTCAAAATAATTACAAAT
TTCATTAATCTAGTGAAGGAAGGATGA60
120
180
240
300
360
420
480
540
567
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1404 [new locus tag: SACOL_RS07145 ]
- symbol: TrpG
- description: anthranilate synthase component II
- length: 188
- theoretical pI: 5.68556
- theoretical MW: 21368.1
- GRAVY: -0.254787
⊟Function[edit | edit source]
- reaction: EC 4.1.3.27? ExPASyAnthranilate synthase Chorismate + L-glutamine = anthranilate + pyruvate + L-glutamate
- TIGRFAM: glutamine amidotransferase of anthranilate synthase or aminodeoxychorismate synthase (TIGR00566; HMM-score: 151)aminodeoxychorismate synthase (TIGR01823; EC 2.6.1.85; HMM-score: 125.7)and 5 moreAmino acid biosynthesis Aromatic amino acid family anthranilate synthase (TIGR01815; EC 4.1.3.27; HMM-score: 115)Purines, pyrimidines, nucleosides, and nucleotides Purine ribonucleotide biosynthesis GMP synthase (glutamine-hydrolyzing), N-terminal domain (TIGR00888; EC 6.3.5.2; HMM-score: 92.5)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis carbamoyl-phosphate synthase, small subunit (TIGR01368; EC 6.3.5.5; HMM-score: 49.5)Amino acid biosynthesis Histidine family imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 28.3)Purines, pyrimidines, nucleosides, and nucleotides Pyrimidine ribonucleotide biosynthesis CTP synthase (TIGR00337; EC 6.3.4.2; HMM-score: 17.5)
- TheSEED :
- Anthranilate synthase, amidotransferase component (EC 4.1.3.27)
- PFAM: Glutaminase_I (CL0014) GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 138.7)and 2 morePeptidase_C26; Peptidase C26 (PF07722; HMM-score: 33.6)GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 15.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9988
- Cytoplasmic Membrane Score: 0
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0011
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.007604
- TAT(Tat/SPI): 0.000165
- LIPO(Sec/SPII): 0.000607
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILVVDNYDSFTYNLVDIVAQHTDVIVQYPDDDNVLNQSVDAVIISPGPGHPLDDQQLMKIISTYQHKPILGICLGAQALTCYYGGEVIKGDKVMHGKVDTLKVISHHQHLLYQDIPEQFSIMRYHSLISNPDNFPEELKITGRTKDCIQSFEHKERPHYGIQYHPESFATDYGVKIITNFINLVKEG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
SACOL0842 (eno) phosphopyruvate hydratase [3] (data from MRSA252) SACOL0988 (fabF) 3-oxoacyl-ACP synthase [3] (data from MRSA252) SACOL0838 (gapA1) glyceraldehyde 3-phosphate dehydrogenase [3] (data from MRSA252) SACOL1734 (gapA2) glyceraldehyde 3-phosphate dehydrogenase 2 [3] (data from MRSA252) SACOL2145 (glmS) glucosamine--fructose-6-phosphate aminotransferase [3] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [3] (data from MRSA252) SACOL1655 (mtn) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase [3] (data from MRSA252) SACOL0583 (rplK) 50S ribosomal protein L11 [3] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [3] (data from MRSA252) SACOL2222 (rpsE) 30S ribosomal protein S5 [3] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [3] (data from MRSA252) SACOL1377 (tkt) transketolase [3] (data from MRSA252) SACOL0594 (tuf) elongation factor Tu [3] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulators: T-box(Trp) (transcription antitermination) regulon, CodY (repression) regulon
T-box(Trp) (RNA) important in Amino acid metabolism; transcription unit transferred from N315 data RegPrecise CodY (TF) important in Amino acid metabolism; RegPrecise transcription unit transferred from N315 data RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p)