From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1590 [new locus tag: SACOL_RS08100 ]
  • pan locus tag?: SAUPAN004109000
  • symbol: SACOL1590
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1590 [new locus tag: SACOL_RS08100 ]
  • symbol: SACOL1590
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 1623926..1624144
  • length: 219
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGCGTAATATAATATTTTATCTTGTACTTATTATTGCTGCGATTGGATTAGTAATGAAT
    CTAGATGCCTTTATTTTTTCAATCGTCAGAATGTTAATCAGCTTTGCTGTAATAGCTGGT
    ATTATTTATCTGATTTATTATTTCTTCATCTTAACTGAAGACCAACGCAAATATCGCAAA
    GCAATGCGTAAGTATAAAAGAAATCAAAGAAGAAAATAG
    60
    120
    180
    219


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1590 [new locus tag: SACOL_RS08100 ]
  • symbol: SACOL1590
  • description: hypothetical protein
  • length: 72
  • theoretical pI: 11.08
  • theoretical MW: 8728.64
  • GRAVY: 0.593056

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssB (TIGR03926; HMM-score: 15.5)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 14.8)
    Cellular processes Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 12.7)
    and 1 more
    integral membrane protein (TIGR04561; HMM-score: 8)
  • TheSEED  :
    • FIG01107940: hypothetical protein
  • PFAM:
    no clan defined Orf78; Orf78 (ac78) (PF06024; HMM-score: 15.7)
    ABC-2 (CL0181) YitT_membrane; Uncharacterised 5xTM membrane BCR, YitT family COG1284 (PF02588; HMM-score: 15.6)
    no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 14.1)
    PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 13.8)
    NTF2 (CL0051) TIM21; TIM21 (PF08294; HMM-score: 13.7)
    and 9 more
    no clan defined DUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 12.3)
    DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 11.8)
    Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 11.4)
    no clan defined COX6C; Cytochrome c oxidase subunit VIc (PF02937; HMM-score: 11)
    Ribophorin_II_C; Ribophorin_II, C-terminal domain (PF25147; HMM-score: 10.7)
    DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 10.3)
    DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 9.9)
    CyanoTRADDas_TM; Cyanobacterial TRADD-N associated 2-Transmembrane domain (PF20712; HMM-score: 9.4)
    TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 7.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.9927
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0073
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: 0.17
    • Signal peptide possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.011143
    • TAT(Tat/SPI): 0.000159
    • LIPO(Sec/SPII): 0.039977
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRKAMRKYKRNQRRK

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]