Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS08100 [old locus tag: SACOL1590 ]
- pan locus tag?: SAUPAN004109000
- symbol: SACOL_RS08100
- pan gene symbol?: —
- synonym:
- product: membrane protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS08100 [old locus tag: SACOL1590 ]
- symbol: SACOL_RS08100
- product: membrane protein
- replicon: chromosome
- strand: +
- coordinates: 1623926..1624144
- length: 219
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGCGTAATATAATATTTTATCTTGTACTTATTATTGCTGCGATTGGATTAGTAATGAAT
CTAGATGCCTTTATTTTTTCAATCGTCAGAATGTTAATCAGCTTTGCTGTAATAGCTGGT
ATTATTTATCTGATTTATTATTTCTTCATCTTAACTGAAGACCAACGCAAATATCGCAAA
GCAATGCGTAAGTATAAAAGAAATCAAAGAAGAAAATAG60
120
180
219
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS08100 [old locus tag: SACOL1590 ]
- symbol: SACOL_RS08100
- description: membrane protein
- length: 72
- theoretical pI: 11.08
- theoretical MW: 8728.64
- GRAVY: 0.593056
⊟Function[edit | edit source]
- TIGRFAM: Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssB (TIGR03926; HMM-score: 15.5)Protein fate Protein and peptide secretion and trafficking preprotein translocase, YajC subunit (TIGR00739; HMM-score: 14.8)Cellular processes Toxin production and resistance bacteriocin-associated integral membrane protein (TIGR01654; HMM-score: 12.7)and 1 moreintegral membrane protein (TIGR04561; HMM-score: 8)
- TheSEED: see SACOL1590
- PFAM: no clan defined Orf78; Orf78 (ac78) (PF06024; HMM-score: 15.7)ABC-2 (CL0181) YitT_membrane; Uncharacterised 5xTM membrane BCR, YitT family COG1284 (PF02588; HMM-score: 15.6)no clan defined PrgI; PrgI family protein (PF12666; HMM-score: 14.1)PKinase (CL0016) YukC; WXG100 protein secretion system (Wss), protein YukC (PF10140; HMM-score: 13.8)NTF2 (CL0051) TIM21; TIM21 (PF08294; HMM-score: 13.7)and 9 moreno clan defined DUF5326; Family of unknown function (DUF5326) (PF17260; HMM-score: 12.3)DUF2207_C; Predicted membrane protein (DUF2207) C-terminal domain (PF20990; HMM-score: 11.8)Peptidase_MA (CL0126) DUF3810; Protein of unknown function (DUF3810) (PF12725; HMM-score: 11.4)no clan defined COX6C; Cytochrome c oxidase subunit VIc (PF02937; HMM-score: 11)Ribophorin_II_C; Ribophorin_II, C-terminal domain (PF25147; HMM-score: 10.7)DUF3671; Fam-L, Fam-M like protein (PF12420; HMM-score: 10.3)DUF5305; Family of unknown function (DUF5305) (PF17231; HMM-score: 9.9)CyanoTRADDas_TM; Cyanobacterial TRADD-N associated 2-Transmembrane domain (PF20712; HMM-score: 9.4)TPR (CL0020) HemY_N; HemY protein N-terminus (PF07219; HMM-score: 7.8)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helices: 2
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9927
- Cell wall & surface Score: 0
- Extracellular Score: 0.0073
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.011143
- TAT(Tat/SPI): 0.000159
- LIPO(Sec/SPII): 0.039977
- predicted transmembrane helices (TMHMM): 2
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRNIIFYLVLIIAAIGLVMNLDAFIFSIVRMLISFAVIAGIIYLIYYFFILTEDQRKYRKAMRKYKRNQRRK
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]