Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL1602 [new locus tag: SACOL_RS08170 ]
- pan locus tag?: SAUPAN004124000
- symbol: SACOL1602
- pan gene symbol?: —
- synonym:
- product: metallo-beta-lactamase
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL1602 [new locus tag: SACOL_RS08170 ]
- symbol: SACOL1602
- product: metallo-beta-lactamase
- replicon: chromosome
- strand: -
- coordinates: 1634303..1634926
- length: 624
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236391 NCBI
- RefSeq: YP_186442 NCBI
- BioCyc: see SACOL_RS08170
- MicrobesOnline: 913051 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAGGATTTCAAGCTTAACTTTAGGCTTAGTTGATACTAATACGTATTTCATCGAAAAT
GACAAAGCTGTTATTCTGATTGACCCTTCAGGTGAAAGTGAAAAAATTATTAAAAAATTA
AACCAAATAAATAAACCGTTAAAAGCTATTTTATTAACACATGCACACTTTGATCATATC
GGAGCAGTCGATGATATAGTTGATCGATTCGATGTCCCGGTTTATATGCATGAAGCAGAG
TTTGATTTTCTAAAAGATCCCGTTAAAAATGGGGCAGATAAATTTAAGCAATATGGATTA
CCAATTATTACAAGTAAGGTAACTCCTGAAAAGTTAAACGAAGGTAGCACAGAAATAGAA
GGATTTAAGTTTAATGTGTTACACACACCTGGACATTCACCAGGAAGTTTAACATATGTG
TTCGATGAATTCGCAGTTGTTGGAGATACATTATTTAATAATGGAATCGGACGTACAGAT
TTATATAAAGGTGATTATGAAACGCTAGTTGATTCTATTCAAGATAAAATATTTGAATTA
GAAGGCGATTTACCTTTATTCCCTGGACATGGTCCATATACGACGGTTGATGATGAACAA
TTAAATCCATTTTTACACGGTTAA60
120
180
240
300
360
420
480
540
600
624
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL1602 [new locus tag: SACOL_RS08170 ]
- symbol: SACOL1602
- description: metallo-beta-lactamase
- length: 207
- theoretical pI: 4.50237
- theoretical MW: 23140.9
- GRAVY: -0.248792
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Detoxification hydroxyacylglutathione hydrolase (TIGR03413; EC 3.1.2.6; HMM-score: 88.5)and 6 moreUnknown function Enzymes of unknown specificity quinoprotein relay system zinc metallohydrolase 1 (TIGR04558; HMM-score: 29.1)Transcription Degradation of RNA beta-CASP ribonuclease, RNase J family (TIGR00649; EC 3.1.-.-; HMM-score: 26.8)arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein (TIGR03675; HMM-score: 19.3)Unknown function Enzymes of unknown specificity quinoprotein relay system zinc metallohydrolase 2 (TIGR04559; EC 3.-.-.-; HMM-score: 17.9)Transcription RNA processing ribonuclease Z (TIGR02651; EC 3.1.26.11; HMM-score: 16.4)Cellular processes DNA transformation DNA internalization-related competence protein ComEC/Rec2 (TIGR00361; HMM-score: 12.9)
- TheSEED :
- MBL-fold metallo-hydrolase superfamily
Carbohydrates Central carbohydrate metabolism Methylglyoxal Metabolism Hydroxyacylglutathione hydrolase (EC 3.1.2.6)and 3 morePotassium metabolism Potassium metabolism - no subcategory Glutathione-regulated potassium-efflux system and associated functions Hydroxyacylglutathione hydrolase (EC 3.1.2.6) - PFAM: Metallo-HOrase (CL0381) Lactamase_B; Metallo-beta-lactamase superfamily (PF00753; HMM-score: 129.8)and 8 moreLactamase_B_2; Beta-lactamase superfamily domain (PF12706; HMM-score: 31.2)ODP; ODP family beta lactamase (PF19583; HMM-score: 24.2)Lactamase_B_3; Beta-lactamase superfamily domain (PF13483; HMM-score: 22.2)Lactamase_B_6; Metallo-beta-lactamase superfamily domain (PF16661; HMM-score: 21.3)PDEase_II; cAMP phosphodiesterases class-II (PF02112; HMM-score: 13.6)no clan defined Fucose_pyrophosphorylase; Fucose pyrophosphorylase domain (PF07959; HMM-score: 12.7)Metallo-HOrase (CL0381) Anti-Pycsar_Apyc1; Anti-Pycsar protein Apyc1 (PF23023; HMM-score: 12.1)no clan defined Ni_insertion; Nickel insertion protein (PF01969; HMM-score: 11.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.995
- Cytoplasmic Membrane Score: 0.001
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0039
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00551
- TAT(Tat/SPI): 0.000077
- LIPO(Sec/SPII): 0.000417
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRISSLTLGLVDTNTYFIENDKAVILIDPSGESEKIIKKLNQINKPLKAILLTHAHFDHIGAVDDIVDRFDVPVYMHEAEFDFLKDPVKNGADKFKQYGLPIITSKVTPEKLNEGSTEIEGFKFNVLHTPGHSPGSLTYVFDEFAVVGDTLFNNGIGRTDLYKGDYETLVDSIQDKIFELEGDLPLFPGHGPYTTVDDEQLNPFLHG
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Cytoplasmic [1] [2] [3]
- quantitative data / protein copy number per cell: 447 [4]
- interaction partners:
SACOL2657 (arcA) arginine deiminase [5] (data from MRSA252) SACOL1494 (asnC) asparaginyl-tRNA synthetase [5] (data from MRSA252) SACOL1637 (dnaK) molecular chaperone DnaK [5] (data from MRSA252) SACOL1329 (femC) glutamine synthetase [5] (data from MRSA252) SACOL1741 (icd) isocitrate dehydrogenase [5] (data from MRSA252) SACOL0204 (pflB) formate acetyltransferase [5] (data from MRSA252) SACOL1274 (rpsB) 30S ribosomal protein S2 [5] (data from MRSA252) SACOL2206 (rpsI) 30S ribosomal protein S9 [5] (data from MRSA252)
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 15.88 h [6]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ 5.0 5.1 5.2 5.3 5.4 5.5 5.6 5.7 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
J Proteome Res: 2011, 10(3);1139-50
[PubMed:21166474] [WorldCat.org] [DOI] (I p) - ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)