From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL1669 [new locus tag: SACOL_RS08515 ]
  • pan locus tag?: SAUPAN004210000
  • symbol: SACOL1669
  • pan gene symbol?:
  • synonym:
  • product: O-methyltransferase

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL1669 [new locus tag: SACOL_RS08515 ]
  • symbol: SACOL1669
  • product: O-methyltransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 1697218..1697856
  • length: 639
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGATGACCTAAATAAAAAATATTTAATAGATTTACATCAACATCAAAATAGTTCAATC
    GAAGTTTTGCGTGAATTTGCCGAGGTAAATGAAGTGCCAATTGTAGATCGTTTAACATTA
    GATTTAATTAAGCAATTAATTCGTATGAATAATGTTAAAAATATTTTAGAAATTGGTACA
    GCAATCGGCTATAGTTCTATGCAATTCGCTTCTATATCTGATGACATTCATGTCACAACG
    ATAGAGCGTAATGAAACGATGATTCAATATGCTAAACAAAATTTAGCTACTTATCATTTT
    GAAAACCAGGTTCGAATTATTGAAGGTAATGCTTTAGAGCAATTTGAAAATGTAAATGAC
    AAAGTTTATGATATGATATTTATTGATGCAGCAAAAGCGCAATCAAAGAAATTTTTTGAA
    ATATATACACCACTTTTAAAGCACCAAGGTCTCGTAATTACAGATAATGTTTTATATCAC
    GGTTTTGTATCGGATATTGGGATTGTTAGATCGAGAAATGTAAGACAAATGGTTAAAAAG
    GTTCAAGATTATAATGAGTGGTTAATAAAGCAACCAGGATATACAACGAATTTTTTAAAT
    ATAGACGATGGATTAGCGATTTCAATTAAAGGAGAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL1669 [new locus tag: SACOL_RS08515 ]
  • symbol: SACOL1669
  • description: O-methyltransferase
  • length: 212
  • theoretical pI: 5.31765
  • theoretical MW: 24526.8
  • GRAVY: -0.255189

Function[edit | edit source]

  • TIGRFAM:
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit (TIGR02469; EC 2.1.1.132; HMM-score: 40.9)
    Genetic information processing Protein fate Protein modification and repair protein-L-isoaspartate O-methyltransferase (TIGR00080; EC 2.1.1.77; HMM-score: 33.3)
    and 13 more
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (TIGR03533; EC 2.1.1.-; HMM-score: 31.2)
    Genetic information processing Protein fate Protein modification and repair protein-(glutamine-N5) methyltransferase, release factor-specific (TIGR03534; EC 2.1.1.-; HMM-score: 27.3)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(527)-N(7))-methyltransferase RsmG (TIGR00138; EC 2.1.1.170; HMM-score: 25.1)
    Genetic information processing Protein fate Protein modification and repair methyltransferase, HemK family (TIGR00536; HMM-score: 24.9)
    methyltransferase, ATP-grasp peptide maturase system (TIGR04188; HMM-score: 23.1)
    Genetic information processing Protein synthesis tRNA and rRNA base modification tRNA (guanine-N(7)-)-methyltransferase (TIGR00091; EC 2.1.1.33; HMM-score: 22.6)
    Genetic information processing Protein synthesis tRNA and rRNA base modification ribosomal RNA small subunit methyltransferase A (TIGR00755; EC 2.1.1.182; HMM-score: 21.7)
    Genetic information processing Protein synthesis tRNA and rRNA base modification 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD (TIGR00095; EC 2.1.1.171; HMM-score: 18)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Biotin malonyl-acyl carrier protein O-methyltransferase BioC (TIGR02072; EC 2.1.1.-; HMM-score: 17.7)
    methyltransferase, FxLD system (TIGR04364; HMM-score: 17.3)
    Unknown function Enzymes of unknown specificity tRNA (cmo5U34)-methyltransferase (TIGR00740; EC 2.1.1.-; HMM-score: 15.9)
    pseudaminic acid biosynthesis-associated methylase (TIGR03587; HMM-score: 15.5)
    methyltransferase, FkbM family (TIGR01444; HMM-score: 13.3)
  • TheSEED  :
    • FIG011945: O-methyltransferase family protein
  • PFAM:
    NADP_Rossmann (CL0063) Methyltransf_3; O-methyltransferase (PF01596; HMM-score: 90.6)
    and 17 more
    Methyltransf_31; Methyltransferase domain (PF13847; HMM-score: 47.2)
    Methyltransf_24; Methyltransferase domain (PF13578; HMM-score: 46.5)
    PCMT; Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) (PF01135; HMM-score: 35.9)
    Methyltransf_25; Methyltransferase domain (PF13649; HMM-score: 30.1)
    MTS; Methyltransferase small domain (PF05175; HMM-score: 29.6)
    Cons_hypoth95; Conserved hypothetical protein 95 (PF03602; HMM-score: 27.6)
    GidB; rRNA small subunit methyltransferase G (PF02527; HMM-score: 26)
    Methyltransf_4; Putative methyltransferase (PF02390; HMM-score: 25.9)
    Methyltransf_15; RNA cap guanine-N2 methyltransferase (PF09445; HMM-score: 21.8)
    CMAS; Mycolic acid cyclopropane synthetase (PF02353; HMM-score: 21.3)
    Methyltransf_12; Methyltransferase domain (PF08242; HMM-score: 20.1)
    Methyltransf_11; Methyltransferase domain (PF08241; HMM-score: 20)
    TRM5-TYW2_MTfase; TRM5/TYW2 methyltransferase domain (PF02475; HMM-score: 19)
    Methyltransf_18; Methyltransferase domain (PF12847; HMM-score: 18.8)
    Pyr_redox; Pyridine nucleotide-disulphide oxidoreductase (PF00070; HMM-score: 16.7)
    RrnaAD; Ribosomal RNA adenine dimethylase (PF00398; HMM-score: 16.4)
    Spermine_synth; Spermine/spermidine synthase domain (PF01564; HMM-score: 15.2)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9945
    • Cytoplasmic Membrane Score: 0.0048
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0004
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004664
    • TAT(Tat/SPI): 0.000192
    • LIPO(Sec/SPII): 0.000152
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MDDLNKKYLIDLHQHQNSSIEVLREFAEVNEVPIVDRLTLDLIKQLIRMNNVKNILEIGTAIGYSSMQFASISDDIHVTTIERNETMIQYAKQNLATYHFENQVRIIEGNALEQFENVNDKVYDMIFIDAAKAQSKKFFEIYTPLLKHQGLVITDNVLYHGFVSDIGIVRSRNVRQMVKKVQDYNEWLIKQPGYTTNFLNIDDGLAISIKGE

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 37 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 13.88 h [5]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]