From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2022 [new locus tag: SACOL_RS10560 ]
  • pan locus tag?: SAUPAN005274000
  • symbol: hld
  • pan gene symbol?: hld
  • synonym:
  • product: delta-hemolysin

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2022 [new locus tag: SACOL_RS10560 ]
  • symbol: hld
  • product: delta-hemolysin
  • replicon: chromosome
  • strand: -
  • coordinates: 2082768..2082902
  • length: 135
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGTTGTTTAATTTTAAGAATTTTTATCTTAATTAAGGAAGGAGTGATTTCAATGGCA
    CAAGATATCATTTCAACAATCGGTGACTTAGTAAAATGGATTATCGACACAGTGAACAAA
    TTCACTAAAAAATAA
    60
    120
    135


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2022 [new locus tag: SACOL_RS10560 ]
  • symbol: Hld
  • description: delta-hemolysin
  • length: 44
  • theoretical pI: 9.46068
  • theoretical MW: 5009.12
  • GRAVY: 0.802273

⊟Function[edit | edit source]

  • TIGRFAM:
  • TheSEED  :
    • hypothetical protein
  • PFAM:
    no clan defined Delta_lysin; Delta lysin family (PF05372; HMM-score: 71.9)
    and 1 more
    PSMdelta; Phenol-soluble modulin delta protein (PF19693; HMM-score: 19.3)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • DeepLocPro: Extracellular
    • Cytoplasmic Score: 0.0025
    • Cytoplasmic Membrane Score: 0.0371
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.9602
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.098909
    • TAT(Tat/SPI): 0.001539
    • LIPO(Sec/SPII): 0.021637
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MSCLILRIFILIKEGVISMAQDIISTIGDLVKWIIDTVNKFTKK

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: AgrA (activation) regulon
    AgrA(TF)important in Virulence, Quorum sensing; compare RegPrecise for N315 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]