From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2026 [new locus tag: SACOL_RS10580 ]
  • pan locus tag?: SAUPAN005281000
  • symbol: agrA
  • pan gene symbol?: agrA
  • synonym:
  • product: accessory gene regulator protein A

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2026 [new locus tag: SACOL_RS10580 ]
  • symbol: agrA
  • product: accessory gene regulator protein A
  • replicon: chromosome
  • strand: +
  • coordinates: 2085180..2085896
  • length: 717
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAATTTTCATTTGCGAAGACGATCCAAAACAAAGAGAAAACATGGTTACCATTATT
    AAAAATTATATAATGATAGAAGAAAAGCCTATGGAAATTGCCCTCGCAACTGATAATCCT
    TATGAGGTGCTTGAGCAAGCTAAAAATATGAATGACATAGGCTGTTACTTTTTAGATATT
    CAACTTTCAACTGATATTAATGGTATCAAATTAGGCAGTGAAATTCGTAAGCATGACCCA
    GTTGGTAACATTATTTTCGTTACGAGTCACAGTGAACTTACCTATTTAACATTTGTCTAC
    AAAGTTGCAGCGATGGATTTTATTTTTAAAGATGATCCAGCTGAATTAAGAACTCGAATT
    ATAGACTGTTTAGAAACTGCACATACACGCTTACAATTGTTGTCTAAAGATAATAGCGTT
    GAAACGATTGAATTAAAACGTGGCAGTAATTCAGTGTATGTTCAATATGATGATATTATG
    TTTTTTGAATCATCAACAAAATCTCACAGACTCATTGCCCATTTAGATAACCGTCAAATT
    GAATTTTATGGTAATTTAAAAGAACTGAGTCAATTAGATGATCGTTTCTTTAGATGTCAT
    AATAGCTTTGTCGTCAATCGCCATAATATTGAATCTATAGATTCGAAAGAGCGAATTGTC
    TATTTTAAAAATAAAGAACACTGCTATGCATCGGTGAGAAACGTTAAAAAAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    717

⊟Protein[edit | edit source]

Protein Data Bank: 4XQJ
Protein Data Bank: 4XQN
Protein Data Bank: 4XQQ
Protein Data Bank: 4XXE
Protein Data Bank: 4XYO
Protein Data Bank: 4XYQ

⊟General[edit | edit source]

  • locus tag: SACOL2026 [new locus tag: SACOL_RS10580 ]
  • symbol: AgrA
  • description: accessory gene regulator protein A
  • length: 238
  • theoretical pI: 6.10039
  • theoretical MW: 27905.7
  • GRAVY: -0.378571

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 11.4)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 11.4)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 11.4)
  • TheSEED  :
    • Response regulator of the competence regulon ComE
  • PFAM:
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 86.9)
    Tudor (CL0049) LytTR; LytTr DNA-binding domain (PF04397; HMM-score: 72.5)
    and 2 more
    no clan defined MinE; Septum formation topological specificity factor MinE (PF03776; HMM-score: 14.4)
    TPR (CL0020) Suf; Suppressor of forked protein (Suf) (PF05843; HMM-score: 12.6)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 10
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0
    • Extracellular Score: 0
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00521
    • TAT(Tat/SPI): 0.000153
    • LIPO(Sec/SPII): 0.000698
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MKIFICEDDPKQRENMVTIIKNYIMIEEKPMEIALATDNPYEVLEQAKNMNDIGCYFLDIQLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [3] [4] [5]
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SACOL1636(dnaJ)chaperone protein DnaJ  [6] (data from MRSA252)
    SACOL1734(gapA2)glyceraldehyde 3-phosphate dehydrogenase 2  [6] (data from MRSA252)
    SACOL1961(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [6] (data from MRSA252)
    SACOL0476(hsdM1)type I restriction-modification system, M subunit  [6] (data from MRSA252)
    SACOL1513(hup)DNA-binding protein HU  [6] (data from MRSA252)
    SACOL0033(mecA)penicillin-binding protein 2'  [6] (data from MRSA252)
    SACOL0584(rplA)50S ribosomal protein L1  [6] (data from MRSA252)
    SACOL1274(rpsB)30S ribosomal protein S2  [6] (data from MRSA252)
    SACOL2233(rpsC)30S ribosomal protein S3  [6] (data from MRSA252)
    SACOL2222(rpsE)30S ribosomal protein S5  [6] (data from MRSA252)
    SACOL2240(rpsJ)30S ribosomal protein S10  [6] (data from MRSA252)
    SACOL0731LysR family transcriptional regulator  [6] (data from MRSA252)
    SACOL1759universal stress protein  [6] (data from MRSA252)
    SACOL2553pyruvate oxidase  [6] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: AgrA (activation) regulon, CodY (repression) regulon
    AgrA(TF)important in Virulence, Quorum sensing; transcription unit transferred from N315 data RegPrecise 
    CodY(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Shu Y Queck, Max Jameson-Lee, Amer E Villaruz, Thanh-Huy L Bach, Burhan A Khan, Daniel E Sturdevant, Stacey M Ricklefs, Min Li, Michael Otto
    RNAIII-independent target gene control by the agr quorum-sensing system: insight into the evolution of virulence regulation in Staphylococcus aureus.
    Mol Cell: 2008, 32(1);150-8
    [PubMed:18851841] [WorldCat.org] [DOI] (I p)
  2. ↑ Tobias Geiger, Patrice Francois, Manuel Liebeke, Martin Fraunholz, Christiane Goerke, Bernhard Krismer, Jacques Schrenzel, Michael Lalk, Christiane Wolz
    The stringent response of Staphylococcus aureus and its impact on survival after phagocytosis through the induction of intracellular PSMs expression.
    PLoS Pathog: 2012, 8(11);e1003016
    [PubMed:23209405] [WorldCat.org] [DOI] (I p)
  3. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  4. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  5. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  6. ↑ 6.00 6.01 6.02 6.03 6.04 6.05 6.06 6.07 6.08 6.09 6.10 6.11 6.12 6.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL2026&oldid=98822"