From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • pan locus tag?: SAUPAN005281000
  • symbol: agrA
  • pan gene symbol?: agrA
  • synonym:
  • product: accessory gene regulator protein A

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • symbol: agrA
  • product: accessory gene regulator protein A
  • replicon: chromosome
  • strand: +
  • coordinates: 2149074..2149700
  • length: 627
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGAAATTGCCCTCGCAACTGATAATCCTTATGAGGTGCTTGAGCAAGCTAAAAATATG
    AATGACATAGGCTGTTACTTTTTAGATATTCAACTTTCAACTGATATTAATGGTATCAAA
    TTAGGCAGTGAAATTCGTAAGCATGACCCAGTTGGTAACATTATTTTCGTTACGAGTCAC
    AGTGAACTTACCTATTTAACATTTGTCTACAAAGTTGCAGCGATGGATTTTATTTTTAAA
    GATGATCCAGCTGAATTAAGAACTCGAATTATAGACTGTTTAGAAACTGCACATACACGC
    TTACAATTGTTGTCTAAAGATAATAGCGTTGAAACGATTGAATTAAAACGTGGCAGTAAT
    TCAGTGTATGTTCAATATGATGATATTATGTTTTTTGAATCATCAACAAAATCTCACAGA
    CTCATTGCCCATTTAGATAACCGTCAAATTGAATTTTATGGTAATTTAAAAGAACTGAGT
    CAATTAGATGATCGTTTCTTTAGATGTCATAATAGCTTTGTCGTCAATCGCCATAATATT
    GAATCTATAGATTCGAAAGAGCGAATTGTCTATTTTAAAAATAAAGAACACTGCTATGCA
    TCGGTGAGAAACGTTAAAAAAATATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    627


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SAUSA300_1992 [new locus tag: SAUSA300_RS10950 ]
  • symbol: AgrA
  • description: accessory gene regulator protein A
  • length: 208
  • theoretical pI: 6.30674
  • theoretical MW: 24253.4
  • GRAVY: -0.362981

⊟Function[edit | edit source]

  • TIGRFAM:
    Metabolism Central intermediary metabolism Nitrogen metabolism nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
    Signal transduction Regulatory functions DNA interactions nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
    Signal transduction Signal transduction Two-component systems nitrogen regulation protein NR(I) (TIGR01818; HMM-score: 10.9)
  • TheSEED  :
    • Response regulator of the competence regulon ComE
  • PFAM:
    SH3 (CL0010) LytTR; LytTr DNA-binding domain (PF04397; HMM-score: 69)
    and 2 more
    CheY (CL0304) Response_reg; Response regulator receiver domain (PF00072; HMM-score: 53.6)
    TadZ-like_ARD; TadZ-like, receiver domain (PF21194; HMM-score: 15.2)

⊟Structure, modifications & cofactors[edit | edit source]

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9399
    • Cytoplasmic Membrane Score: 0.0335
    • Cell wall & surface Score: 0.0003
    • Extracellular Score: 0.0264
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004856
    • TAT(Tat/SPI): 0.000098
    • LIPO(Sec/SPII): 0.000909
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MEIALATDNPYEVLEQAKNMNDIGCYFLDIQLSTDINGIKLGSEIRKHDPVGNIIFVTSHSELTYLTFVYKVAAMDFIFKDDPAELRTRIIDCLETAHTRLQLLSKDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:
    SAUSA300_2477(cidC)pyruvate oxidase  [3] (data from MRSA252)
    SAUSA300_1539(dnaJ)chaperone protein DnaJ  [3] (data from MRSA252)
    SAUSA300_1633(gap)glyceraldehyde 3-phosphate dehydrogenase 2  [3] (data from MRSA252)
    SAUSA300_1881(gatA)aspartyl/glutamyl-tRNA amidotransferase subunit A  [3] (data from MRSA252)
    SAUSA300_0405(hsdM)type I restriction-modification system, M subunit  [3] (data from MRSA252)
    SAUSA300_1362(hup)DNA-binding protein HU  [3] (data from MRSA252)
    SAUSA300_0032(mecA)penicillin-binding protein 2'  [3] (data from MRSA252)
    SAUSA300_0523(rplA)50S ribosomal protein L1  [3] (data from MRSA252)
    SAUSA300_1149(rpsB)30S ribosomal protein S2  [3] (data from MRSA252)
    SAUSA300_2198(rpsC)30S ribosomal protein S3  [3] (data from MRSA252)
    SAUSA300_2187(rpsE)30S ribosomal protein S5  [3] (data from MRSA252)
    SAUSA300_2205(rpsJ)30S ribosomal protein S10  [3] (data from MRSA252)
    SAUSA300_0658LysR family transcriptional regulator  [3] (data from MRSA252)
    SAUSA300_1656universal stress protein  [3] (data from MRSA252)

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulators: AgrA (activation) regulon, CodY (repression) regulon
    AgrA(TF)important in Virulence, Quorum sensing; transcription unit transferred from N315 data RegPrecise 
    CodY(TF)important in Amino acid metabolism; RegPrecise    transcription unit transferred from N315 data RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Shu Y Queck, Max Jameson-Lee, Amer E Villaruz, Thanh-Huy L Bach, Burhan A Khan, Daniel E Sturdevant, Stacey M Ricklefs, Min Li, Michael Otto
    RNAIII-independent target gene control by the agr quorum-sensing system: insight into the evolution of virulence regulation in Staphylococcus aureus.
    Mol Cell: 2008, 32(1);150-8
    [PubMed:18851841] [WorldCat.org] [DOI] (I p)
  2. ↑ Tobias Geiger, Patrice Francois, Manuel Liebeke, Martin Fraunholz, Christiane Goerke, Bernhard Krismer, Jacques Schrenzel, Michael Lalk, Christiane Wolz
    The stringent response of Staphylococcus aureus and its impact on survival after phagocytosis through the induction of intracellular PSMs expression.
    PLoS Pathog: 2012, 8(11);e1003016
    [PubMed:23209405] [WorldCat.org] [DOI] (I p)
  3. ↑ 3.00 3.01 3.02 3.03 3.04 3.05 3.06 3.07 3.08 3.09 3.10 3.11 3.12 3.13 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J Proteome Res: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SAUSA300_1992&oldid=143192"