From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2291 [new locus tag: SACOL_RS12045 ]
  • pan locus tag?: SAUPAN005767000
  • symbol: SACOL2291
  • pan gene symbol?: ssaA
  • synonym:
  • product: staphyloxanthin biosynthesis protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2291 [new locus tag: SACOL_RS12045 ]
  • symbol: SACOL2291
  • product: staphyloxanthin biosynthesis protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2351332..2352135
  • length: 804
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAGAAAATCGCTACAGCTACTATCGCAACTGCAGGATTCGCTACAATCGCAATTGCA
    TCAGGAAATCAAGCTCATGCTTCTGAGCAAGATAACTACGGTTATAATCCAAACGACCCA
    ACATCATATAGCTATACTTACACTATTGATGCACAAGGTAACTACCATTACACATGGAAA
    GGTAACTGGCATCCAAGTCAATTAAACCAAGATAATGGCTACTACAGCTATTACTACTAC
    AATGGTTACAATAACTATAACAATTACAACAACGGTTATAGCTACAATAACTACAGCCGT
    TACAACAACTACTCAAATAATAATCAATCATATAACTACAATAACTATAATAGTTACAAC
    ACAAACAGCTACCGTACTGGTGGTTTAGGTGCAAGCTACAGCACTTCAAGCAACAATGTT
    CAAGTAACTACAACTATGGCTCCATCATCAAATGGCCGTTCAATCTCAAGTGGTTATACT
    TCAGGACGTAACTTATACACTTCTGGTCAATGTACATACTACGTATTTGATCGTGTAGGT
    GGTAAAATCGGTTCAACTTGGGGCAATGCAAGTAACTGGGCTAACGCAGCTGCAAGAGCT
    GGTTACACAGTGAACAATACACCAAAAGCTGGTGCAATTATGCAAACAACTCAAGGTGCA
    TACGGTCACGTTGCATACGTTGAAAGTGTTAACAGCAATGGTTCAGTAAGAGTTTCAGAA
    ATGAACTATGGTTATGGCCCAGGTGTTGTAACTTCACGTACAATCTCAGCTAGCCAAGCT
    GCTGGTTATAACTTCATTCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    804

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2291 [new locus tag: SACOL_RS12045 ]
  • symbol: SACOL2291
  • description: staphyloxanthin biosynthesis protein
  • length: 267
  • theoretical pI: 9.09862
  • theoretical MW: 29327
  • GRAVY: -0.846816

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED:  
    Secretory antigen precursor SsaA
  • PFAM:
    Peptidase_CA (CL0125) CHAP; CHAP domain (PF05257; HMM-score: 54.3)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.02
    • Extracellular Score: 9.98
    • Internal Helices: 0
  • LocateP: Secretory(released) (with CS)
    • Prediction by SwissProt Classification: Extracellular
    • Pathway Prediction: Sec-(SPI)
    • Intracellular possibility: -0.17
    • Signal peptide possibility: 1
    • N-terminally Anchored Score: -2
    • Predicted Cleavage Site: NQAHASEQ
  • SignalP: Signal peptide SP(Sec/SPI) length 27 aa
    • SP(Sec/SPI): 0.998381
    • TAT(Tat/SPI): 0.000739
    • LIPO(Sec/SPII): 0.000657
    • Cleavage Site: CS pos: 27-28. AHA-SE. Pr: 0.9903
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWKGNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYNTNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVGGKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSEMNYGYGPGVVTSRTISASQAAGYNFIH

Experimental data[edit | edit source]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • SACOL2291 no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]