Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2300 [new locus tag: SACOL_RS12100 ]
- pan locus tag?: SAUPAN005785000
- symbol: SACOL2300
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2300 [new locus tag: SACOL_RS12100 ]
- symbol: SACOL2300
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2360653..2361126
- length: 474
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237372 NCBI
- RefSeq: YP_187107 NCBI
- BioCyc:
- MicrobesOnline: 913782 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGGCTGAGAGAATATCTTCTAAAATTAGACGCTTAGAAAAATCAGAAGAACAAATTAAG
TTAGAAAGTTTAAATGAAGTTACAGAGGCAATTGCAGCGAATAAAGATAGTATATTAAAA
GCAATCAAGCTTATTAAAACATTAGATGATGCAAAACTATTAGATGCTTTAAATGGTGCA
ATTCGAGGACGTCAAGTCATCATAAATAAATTTGCAGTTGAACTTAATAAAGATATTTAT
ACAGGGCTATTATCTAATATGGCTTCAATGGTATTTTTATTAGGTGAACTCAATGTATCA
GATTTAAGCGACTTCCTAAATAAAGTTAATAAAGGATTACACGTTGCCAATCAAGCGAGT
CCAAATGCTAAGACAACTATAAGAAGTCTATTGGGCGTATTGAAAGATGACGACATGAAC
CGTAGTTTAACATACATGCTTAATATGCTAAAAGGTATGTCTCGAGAAGAATAA60
120
180
240
300
360
420
474
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2300 [new locus tag: SACOL_RS12100 ]
- symbol: SACOL2300
- description: hypothetical protein
- length: 157
- theoretical pI: 9.49505
- theoretical MW: 17478.2
- GRAVY: -0.158599
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED:
- PFAM: no clan defined DUF1641; Protein of unknown function (DUF1641) (PF07849; HMM-score: 43.4)and 3 morePhage_HK97_TLTM; Tail length tape measure protein (PF06120; HMM-score: 14.7)DUF362 (CL0471) DUF2088; Domain of unknown function (DUF2088) (PF09861; HMM-score: 11.7)no clan defined YlbD_coat; Putative coat protein (PF14071; HMM-score: 8.5)
⊟Structure, modifications & interactions[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
- protein partners:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.0019
- TAT(Tat/SPI): 0.000231
- LIPO(Sec/SPII): 0.00018
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAERISSKIRRLEKSEEQIKLESLNEVTEAIAANKDSILKAIKLIKTLDDAKLLDALNGAIRGRQVIINKFAVELNKDIYTGLLSNMASMVFLLGELNVSDLSDFLNKVNKGLHVANQASPNAKTTIRSLLGVLKDDDMNRSLTYMLNMLKGMSREE
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlasquantitative data / protein copy number per cell: 326 [4]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator: RpoF* (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: 15.17 h [7]
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑
Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑
Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑
Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑
Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑
Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑
Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p) - ↑
Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
Mol Cell Proteomics: 2012, 11(9);558-70
[PubMed:22556279] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]