From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
  • pan locus tag?: SAUPAN005790000
  • symbol: SACOL2304
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
  • symbol: SACOL2304
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 2366944..2367636
  • length: 693
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAATAAAGCTGAAAGGCAAAATTTAATAATTACTGCAATTCAACAAAATAAAAAAATG
    ACCGCTTTAGAATTAGCTAAATATTGCAACGTATCCAAACGCACAATTTTAAGAGATATT
    GATGATTTAGAAAATCAAGGTGTTAAAATTTATGCGCATTATGGGAAAAATGGTGGTTAC
    CAAATACAACAAGCACAATCTAAAATTGCATTAAACTTATCTGAAACACAATTATCAGCC
    TTATTTTTAGTGCTTAATGAAAGTCAGTCGTACTCGACATTACCATATAAAAGCGAAATC
    AACGCAATTATAAAACAATGTTTAAGTCTTCCACAAACACGCTTAAGAAAATTGCTTAAA
    CGCATGGACTTTTATATTAAATTTGATGACACACAACATATGACACTCCCAATGCTGTTT
    TCCGACATTTTAATTTATTGTACAGAACGAAATGTGATGTTAGTAGATCATAGGGTTGAT
    GATAATATTAAAGCTGAAAACGTTATATTTATTGGCCTTTTGTGTAAACATGGACATTGG
    CATGCAGTCATTTATGACATTGCTCAAGACAAAACTGCCGAACTCGAAATTGAAAATATT
    ATAGATATTTCGTATTCATTCGGTAAGACGATTCAAACCAGAGACATATCCATTGATAAC
    TATCATCAATTTTTAAACCCCATCGATTCCTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    693


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL2304 [new locus tag: SACOL_RS12120 ]
  • symbol: SACOL2304
  • description: hypothetical protein
  • length: 230
  • theoretical pI: 7.17682
  • theoretical MW: 26618.5
  • GRAVY: -0.268261

⊟Function[edit | edit source]

  • TIGRFAM:
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 17.7)
    Genetic information processing DNA metabolism DNA replication, recombination, and repair DnaD family protein (TIGR04548; HMM-score: 16.8)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 15.5)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other FeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    Signal transduction Regulatory functions DNA interactions FeS assembly SUF system regulator (TIGR02944; HMM-score: 15)
    and 4 more
    Unknown function General DNA binding domain, excisionase family (TIGR01764; HMM-score: 14)
    Metabolism Biosynthesis of cofactors, prosthetic groups, and carriers Other iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transduction Regulatory functions DNA interactions iron-sulfur cluster biosynthesis transcriptional regulator SufR (TIGR02702; HMM-score: 13)
    Signal transduction Regulatory functions DNA interactions biotin operon repressor (TIGR00122; HMM-score: 12.1)
  • TheSEED  :
    • Transcriptional regulator, DeoR family
  • PFAM:
    HTH (CL0123) HTH_11; HTH domain (PF08279; HMM-score: 48.3)
    and 14 more
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 36.9)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 23.3)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 21.8)
    HTH_Mga; M protein trans-acting positive regulator (MGA) HTH domain (PF08280; HMM-score: 18.4)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 16.8)
    Tn7_Tnp_TnsA_C; TnsA endonuclease C terminal (PF08721; HMM-score: 15.1)
    no clan defined Dicer_PBD; Dicer, partner-binding domain (PF20930; HMM-score: 14.1)
    HTH (CL0123) MarR; MarR family (PF01047; HMM-score: 13.7)
    TBPIP; TBPIP/Hop2 winged helix domain (PF07106; HMM-score: 13.6)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 13.6)
    HTH_AsnC-type; AsnC-type helix-turn-helix domain (PF13404; HMM-score: 12.8)
    HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 12.5)
    HTH_PafC; PafC helix-turn-helix domain (PF19187; HMM-score: 12.1)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 11.9)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.8786
    • Cytoplasmic Membrane Score: 0.0728
    • Cell wall & surface Score: 0.0021
    • Extracellular Score: 0.0465
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.017591
    • TAT(Tat/SPI): 0.000918
    • LIPO(Sec/SPII): 0.002332
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MNKAERQNLIITAIQQNKKMTALELAKYCNVSKRTILRDIDDLENQGVKIYAHYGKNGGYQIQQAQSKIALNLSETQLSALFLVLNESQSYSTLPYKSEINAIIKQCLSLPQTRLRKLLKRMDFYIKFDDTQHMTLPMLFSDILIYCTERNVMLVDHRVDDNIKAENVIFIGLLCKHGHWHAVIYDIAQDKTAELEIENIIDISYSFGKTIQTRDISIDNYHQFLNPIDS

⊟Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 143 [4]
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator: CcpA regulon
    CcpA(TF)important in Carbon catabolism; RegPrecise 

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: 51.2 h [5]

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]

  1. ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  5. ↑ Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

⊟Relevant publications[edit | edit source]