From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2329 [new locus tag: SACOL_RS12245 ]
  • pan locus tag?: SAUPAN005825000
  • symbol: rpiA
  • pan gene symbol?: rpiA
  • synonym:
  • product: ribose-5-phosphate isomerase A

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2329 [new locus tag: SACOL_RS12245 ]
  • symbol: rpiA
  • product: ribose-5-phosphate isomerase A
  • replicon: chromosome
  • strand: -
  • coordinates: 2392091..2392777
  • length: 687
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAGATGTCAAAGCACTCAAGTTAATGACATTAAATGATGTTTTAAGTCAAATCAAT
    GGTGACATGACGCTGGGAATTGGTACAGGAAGTACAATGGAATTACTCTTACCTCAAATG
    GCGCAACTAATTAAAGAACGTGGTTACAATATTACAGGTGTATGCACTTCTAATAAAATT
    GCATTTTTAGCAAAAGAATTAGGTATTAAAATATGTGAAATCAATGATGTTGATCATATC
    GACTTAGCAATTGATGGTGCTGATGAAGTAGATCCATCTTTAAATATAATTAAAGGTGGC
    GGTGGTGCGCTGTTCAGAGAGAAAGTTATAGATGAAATGGCATCGCGTTTTGTTGTGGTT
    GTCGATGAAACGAAAATAGTTCAATACTTAGGTGAGACGTTTAAGTTACCAGTAGAGGTG
    GATAAATTTAACTGGTATCAGATATTACGTAAAATTGAATCATACGCTGATATAAAAGTA
    GAACGTCGTGTAAACGAAGATGTCGCATTTATAACTGATAATGGCAATTATATTTTAGAT
    TGTAAGTTACCAAAAGGAATTGACCCATATAAGTTCCATGAGTATTTAATTCATCTGACA
    GGTGTGTTTGAGACAGGATACTTCTTAGATATGGCAGATCAAGTTATTGTAGGCACTCAA
    GAGGGTGTTAAAATTTTAGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2329 [new locus tag: SACOL_RS12245 ]
  • symbol: RpiA
  • description: ribose-5-phosphate isomerase A
  • length: 228
  • theoretical pI: 4.54963
  • theoretical MW: 25540.4
  • GRAVY: 0.0192982

Function[edit | edit source]

  • reaction:
    EC 5.3.1.6?  ExPASy
    Ribose-5-phosphate isomerase D-ribose 5-phosphate = D-ribulose 5-phosphate
  • TIGRFAM:
    Metabolism Energy metabolism Pentose phosphate pathway ribose 5-phosphate isomerase A (TIGR00021; EC 5.3.1.6; HMM-score: 262.1)
  • TheSEED:  
    Carbohydrates Central carbohydrate metabolism Dihydroxyacetone kinases  Ribose 5-phosphate isomerase A (EC 5.3.1.6)
    and 3 more
    Glycolate, glyoxylate interconversions  Ribose 5-phosphate isomerase A (EC 5.3.1.6)
    Pentose phosphate pathway  Ribose 5-phosphate isomerase A (EC 5.3.1.6)
    Monosaccharides D-ribose utilization  Ribose 5-phosphate isomerase A (EC 5.3.1.6)
  • PFAM:
    ISOCOT_Fold (CL0246) Rib_5-P_isom_A; Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026; HMM-score: 200.5)
    and 2 more
    DeoRC; DeoR C terminal sensor domain (PF00455; HMM-score: 15.2)
    no clan defined Flavoprotein; Flavoprotein (PF02441; HMM-score: 12.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012933
    • TAT(Tat/SPI): 0.001009
    • LIPO(Sec/SPII): 0.001056
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKDVKALKLMTLNDVLSQINGDMTLGIGTGSTMELLLPQMAQLIKERGYNITGVCTSNKIAFLAKELGIKICEINDVDHIDLAIDGADEVDPSLNIIKGGGGALFREKVIDEMASRFVVVVDETKIVQYLGETFKLPVEVDKFNWYQILRKIESYADIKVERRVNEDVAFITDNGNYILDCKLPKGIDPYKFHEYLIHLTGVFETGYFLDMADQVIVGTQEGVKILEK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
    experimental localization: Cytoplasmic [1] [2] [3] [4]
    quantitative data / protein copy number per cell: 93 [5]

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

  • rpiA no polycistronic organisation predicted

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: 44.72 h [6]

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
    Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
    J Proteome Res: 2010, 9(3);1579-90
    [PubMed:20108986] [WorldCat.org] [DOI] (I p)
  3. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  4. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  5. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)
  6. Stephan Michalik, Jörg Bernhardt, Andreas Otto, Martin Moche, Dörte Becher, Hanna Meyer, Michael Lalk, Claudia Schurmann, Rabea Schlüter, Holger Kock, Ulf Gerth, Michael Hecker
    Life and death of proteins: a case study of glucose-starved Staphylococcus aureus.
    Mol Cell Proteomics: 2012, 11(9);558-70
    [PubMed:22556279] [WorldCat.org] [DOI] (I p)

Relevant publications[edit | edit source]