Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
- pan locus tag?: SAUPAN005883000
- symbol: SACOL2365
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
- symbol: SACOL2365
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2426087..2426716
- length: 630
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238203 NCBI
- RefSeq: YP_187170 NCBI
- BioCyc: see SACOL_RS12420
- MicrobesOnline: 913846 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601ATGAAAAGATTAGTTACAGGGTTACTAGCATTATCATTATTTTTAGCTGCATGTGGTCAA
GATAGTGACCAACAAAAAGACGGTAATAAAGAAAAAGATGATAAAGCGAAAACTGAACAA
CAAGATAAAAAAACAAATGATTCATCTAAAGATAAGAAAGATAATAAAGATGATAGTAAA
GACGTAAACAAAGATAATAAAGATAATAGTGCAAACGATAACCAGCAACAATCTAATTCA
AATGCAACAAACAATGACCAAAACCAAACAAATAATAACCAATCAAGTAATAACCAAGCG
AATAATAATCAAAAATCAAGTTACGTTGCACCATATTATGGACAAAATGCCGCGCCGGTT
GCACGTCAAATTTATCCGTTTAATGGAAATAAAAATCAAGCTTTACAGCAATTGCCAAAT
TTCCAAACAGCTTTAAATGCGGCTAATAATGAAGCAAATAAATTTGGTAGTAATAATAAA
GTGTATAATGATTATTCTATTGAAGAACATAATGGCAACTATAAGTATGTGTTTAGTTTT
AAAGACCCAAATGCAAATGGAAAATATTCAATTGTAACGGTTGATTATACTGGACAAGCA
ATGGTTACTGATCCAAACTACCAACAATAA60
120
180
240
300
360
420
480
540
600
630
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2365 [new locus tag: SACOL_RS12420 ]
- symbol: SACOL2365
- description: hypothetical protein
- length: 209
- theoretical pI: 5.97547
- theoretical MW: 23361.8
- GRAVY: -1.44067
⊟Function[edit | edit source]
- TIGRFAM: Sec region non-globular protein (TIGR04420; HMM-score: 17.8)Cellular processes Cell division cell division protein ZipA (TIGR02205; HMM-score: 14.5)and 6 moretype IV conjugative transfer system protein TraV (TIGR02747; HMM-score: 13.7)cobaltochelatase subunit (TIGR02442; EC 6.6.1.2; HMM-score: 9)Energy metabolism TCA cycle dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 6.3)Transport and binding proteins Cations and iron carrying compounds potassium uptake protein, Trk family (TIGR00934; HMM-score: 5.8)Biosynthesis of cofactors, prosthetic groups, and carriers Heme, porphyrin, and cobalamin cobaltochelatase, CobT subunit (TIGR01651; EC 6.6.1.2; HMM-score: 4.7)Protein fate Protein and peptide secretion and trafficking type VII secretion protein EssA (TIGR03927; HMM-score: 4.1)
- TheSEED :
- hypothetical protein similar to TpgX
- PFAM: AhpD-like (CL0423) PA26; PA26 p53-induced protein (sestrin) (PF04636; HMM-score: 17)HAD (CL0137) CDC45; CDC45 (PF02724; HMM-score: 13.7)and 20 moreMFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 13)no clan defined PCYCGC; Protein of unknown function with PCYCGC motif (PF13798; HMM-score: 12.6)LppaM (CL0421) LPAM_2; Prokaryotic lipoprotein-attachment site (PF13627; HMM-score: 11.9)no clan defined Nop14; Nop14-like family (PF04147; HMM-score: 11.8)Peptidase_AD (CL0130) Presenilin; Presenilin (PF01080; HMM-score: 10.7)no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 10.1)SLC12; Solute carrier family 12 (PF03522; HMM-score: 9.7)DUF6474; Family of unknown function (DUF6474) (PF20079; HMM-score: 8.4)DMT (CL0184) Zip; ZIP Zinc transporter (PF02535; HMM-score: 8.1)no clan defined TMEM51; Transmembrane protein 51 (PF15345; HMM-score: 7.6)MCM_bind; Mini-chromosome maintenance replisome factor (PF09739; HMM-score: 7.5)FUSC (CL0307) ALMT; Aluminium activated malate transporter (PF11744; HMM-score: 7.5)no clan defined DUF4614; Domain of unknown function (DUF4614) (PF15391; HMM-score: 7.5)Mat89Bb; Cell cycle and development regulator Mat89Bb (PF10221; HMM-score: 7.1)GCV_T_C (CL0740) POP1_C; POP1 C-terminal domain (PF22770; HMM-score: 6.9)Peptidase_PA (CL0124) Peptidase_S64; Peptidase family S64 (PF08192; HMM-score: 6.7)NPR (CL0435) NPR3; Nitrogen Permease regulator of amino acid transport activity 3 (PF03666; HMM-score: 6.4)no clan defined Otopetrin; Otopetrin (PF03189; HMM-score: 5.9)DUF7502; Family of unknown function (DUF7502) (PF24334; HMM-score: 5.8)Raftlin; Raftlin (PF15250; HMM-score: 5.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 7.21
- Cellwall Score: 1.45
- Extracellular Score: 1.34
- Internal Helices: 0
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0002
- Cytoplasmic Membrane Score: 0.7858
- Cell wall & surface Score: 0.0367
- Extracellular Score: 0.1773
- LocateP: Lipid anchored
- Prediction by SwissProt Classification: Extracellular
- Pathway Prediction: Sec-(SPII)
- Intracellular possibility: -0.33
- Signal peptide possibility: 1
- N-terminally Anchored Score: -1
- Predicted Cleavage Site: FLAACGQ
- SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
- SP(Sec/SPI): 0.000394
- TAT(Tat/SPI): 0.000051
- LIPO(Sec/SPII): 0.999411
- Cleavage Site: CS pos: 17-18. LAA-CG. Pr: 0.9998
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKRLVTGLLALSLFLAACGQDSDQQKDGNKEKDDKAKTEQQDKKTNDSSKDKKDNKDDSKDVNKDNKDNSANDNQQQSNSNATNNDQNQTNNNQSSNNQANNNQKSSYVAPYYGQNAAPVARQIYPFNGNKNQALQQLPNFQTALNAANNEANKFGSNNKVYNDYSIEEHNGNYKYVFSFKDPNANGKYSIVTVDYTGQAMVTDPNYQQ
⊟Experimental data[edit | edit source]
- experimentally validated: PeptideAtlas
- protein localization: Lipoprotein [1] [2] [3] [4]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB* (activation) regulon
SigB* (sigma factor) controlling a large regulon involved in stress/starvation response and adaptation; [5] other strains
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p)