Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2379 [new locus tag: SACOL_RS12490 ]
- pan locus tag?: SAUPAN005907000
- symbol: SACOL2379
- pan gene symbol?: —
- synonym: JSNZ_002350
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2379 [new locus tag: SACOL_RS12490 ]
- symbol: SACOL2379
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2439936..2440358
- length: 423
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3237628 NCBI
- RefSeq: YP_187183 NCBI
- BioCyc: see SACOL_RS12490
- MicrobesOnline: 913859 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421ATGAGTAACTCACAAGCAATTCAAGCAATTGAAAACGTGTTAGCAACGTCAAAAGTTGGT
GTATTATCAACTGCATATAATAATAAACCTAATAGTAGATATATGGTCTTTTATAATGAT
GGTCTTACTTTATATACTAAAACGAATATCCATTCTGCTAAGGTCAAAGAAATTAAAGAT
AATCCAGCAGCATATGTTTTGTTAGGCTATAACGACACAACTAATCGTAGTTTCGTTGAG
ATGGAAGCGACAATCGAAATCGTTACAGAACAAGAAGTGATTGATTGGCTATGGGAAACA
CAAGACAAAAGCTTTTTCAGTTCAAAAGAAGACCCAGAGTTATGTGTTTTAAGAGTAGTT
CCGCAATCCATTAAGCTAATGAATGATAAATCATTAGATACACCTATCAAAATCGATTTA
TAA60
120
180
240
300
360
420
423
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2379 [new locus tag: SACOL_RS12490 ]
- symbol: SACOL2379
- description: hypothetical protein
- length: 140
- theoretical pI: 4.59694
- theoretical MW: 15885.9
- GRAVY: -0.296429
⊟Function[edit | edit source]
- TIGRFAM: Unknown function Enzymes of unknown specificity PPOX class probable F420-dependent enzyme (TIGR03618; HMM-score: 26.7)and 3 moreUnknown function Enzymes of unknown specificity PPOX class probable F420-dependent enzyme, Rv3369 family (TIGR03667; EC 1.-.-.-; HMM-score: 18.3)Biosynthesis of cofactors, prosthetic groups, and carriers Pyridoxine pyridoxamine 5'-phosphate oxidase (TIGR00558; EC 1.4.3.5; HMM-score: 18)Unknown function Enzymes of unknown specificity PPOX class probable FMN-dependent enzyme, alr4036 family (TIGR04026; EC 1.-.-.-; HMM-score: 14.2)
- TheSEED :
- General stress protein 26
- PFAM: FMN-binding (CL0336) PNPOx_N; Pyridoxamine 5'-phosphate oxidase (PF01243; HMM-score: 59.4)and 3 morePyrid_ox_like; Pyridoxamine 5'-phosphate oxidase like (PF16242; HMM-score: 44.7)Pyridox_ox_2; Pyridoxamine 5'-phosphate oxidase (PF12900; HMM-score: 18)SH3 (CL0010) Tudor_5; Histone methyltransferase Tudor domain 1 (PF18359; HMM-score: 14.4)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9884
- Cytoplasmic Membrane Score: 0.0011
- Cell wall & surface Score: 0
- Extracellular Score: 0.0105
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.022377
- TAT(Tat/SPI): 0.002178
- LIPO(Sec/SPII): 0.01634
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSNSQAIQAIENVLATSKVGVLSTAYNNKPNSRYMVFYNDGLTLYTKTNIHSAKVKEIKDNPAAYVLLGYNDTTNRSFVEMEATIEIVTEQEVIDWLWETQDKSFFSSKEDPELCVLRVVPQSIKLMNDKSLDTPIKIDL
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: SigB*/JSNZ_002025 (activation) regulon
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Kristina Hempel, Jan Pané-Farré, Andreas Otto, Susanne Sievers, Michael Hecker, Dörte Becher
Quantitative cell surface proteome profiling for SigB-dependent protein expression in the human pathogen Staphylococcus aureus via biotinylation approach.
J Proteome Res: 2010, 9(3);1579-90
[PubMed:20108986] [WorldCat.org] [DOI] (I p) - ↑ Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
J Proteome Res: 2011, 10(4);1657-66
[PubMed:21323324] [WorldCat.org] [DOI] (I p) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p) - ↑ Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
Sci Rep: 2016, 6;28172
[PubMed:27344979] [WorldCat.org] [DOI] (I e) - ↑ Markus Bischoff, Paul Dunman, Jan Kormanec, Daphne Macapagal, Ellen Murphy, William Mounts, Brigitte Berger-Bächi, Steven Projan
Microarray-based analysis of the Staphylococcus aureus sigmaB regulon.
J Bacteriol: 2004, 186(13);4085-99
[PubMed:15205410] [WorldCat.org] [DOI] (P p) - ↑ Jan Pané-Farré, Beate Jonas, Konrad Förstner, Susanne Engelmann, Michael Hecker
The sigmaB regulon in Staphylococcus aureus and its regulation.
Int J Med Microbiol: 2006, 296(4-5);237-58
[PubMed:16644280] [WorldCat.org] [DOI] (P p)

