Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2503 [new locus tag: SACOL_RS13115 ]
- pan locus tag?: SAUPAN006093000
- symbol: SACOL2503
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2503 [new locus tag: SACOL_RS13115 ]
- symbol: SACOL2503
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2557013..2557321
- length: 309
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238261 NCBI
- RefSeq: YP_187298 NCBI
- BioCyc: see SACOL_RS13115
- MicrobesOnline: 913976 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301ATGACCGTCAACATCGTATTTAGTATCGTATTCTGCATAAGTATGGTTATATTAGGCATT
TATGTCGCAATAACTAAAGATTTCACACTAATCTCTTTTATAAATCAAACGGCCATTGCA
GATAAACACAAGAACCAAATTGCATATATATTTACGCTATGTATAAGTTTGAGTGCAGTA
TTTTTAATGTCTTCAATTCTAAGCTTTGAATATGATTTTATTGCATTAGCATTCTTATTT
TTAACGATAGCATTATTACTTATCGCATTATTCTACGTTTGCTTTTATAAAATTACAAAA
TACCCATAA60
120
180
240
300
309
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2503 [new locus tag: SACOL_RS13115 ]
- symbol: SACOL2503
- description: hypothetical protein
- length: 102
- theoretical pI: 8.02924
- theoretical MW: 11604
- GRAVY: 1.40196
⊟Function[edit | edit source]
- TIGRFAM: oligosaccharyl transferase, archaeosortase A system-associated (TIGR04154; EC 2.4.1.-; HMM-score: 2.7)
- TheSEED :
- FIG01108453: hypothetical protein
- PFAM: Hypoth_1 (CL0447) DUF1304; Protein of unknown function (DUF1304) (PF06993; HMM-score: 11.5)and 2 moreBPD_transp_1 (CL0404) FtsX; FtsX-like permease family (PF02687; HMM-score: 7.2)Ion_channel (CL0030) Lig_chan; Ligand-gated ion channel (PF00060; HMM-score: 6.3)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 10
- Cellwall Score: 0
- Extracellular Score: 0
- Internal Helices: 3
- LocateP: Multi-transmembrane
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -0.5
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.009957
- TAT(Tat/SPI): 0.000153
- LIPO(Sec/SPII): 0.010158
- predicted transmembrane helices (TMHMM): 3
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MTVNIVFSIVFCISMVILGIYVAITKDFTLISFINQTAIADKHKNQIAYIFTLCISLSAVFLMSSILSFEYDFIALAFLFLTIALLLIALFYVCFYKITKYP
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.