From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL2551 [new locus tag: SACOL_RS13355 ]
  • pan locus tag?: SAUPAN006191000
  • symbol: SACOL2551
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL2551 [new locus tag: SACOL_RS13355 ]
  • symbol: SACOL2551
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2608181..2608591
  • length: 411
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGACAACAGAAGGTCTATTAGTTGCAGAGAAAGAAATCGAAGTGAATGGTTACGACATT
    GATGCGATGGGTGTCGTTAGTAATATCGTTTATATTAGATGGTTCGAAGATTTGAGAACA
    GCGTTTATTAATCAGCACATGAATTACTCAACAATGATCAATCAAGGCATTTCACCTATA
    CTTATGAAAACGGAAGCAGAGTATAAAGTACCTGTCACAATACATGACAAACCAGTAGGT
    CGTATTTACTTAGTTAAAGCAAGCAAGATGAAATGGGTGTTTCAGTTTGAAATTGTGTCC
    GCACATGGCGTGCATTGTATTGGTACACAGACAGGCGGTTTTTACAGATTGAGTGATAAG
    AAGATAACCTCTGTGCCACAAGTGTTTCAAGACATTTTAGCAACAAAATAA
    60
    120
    180
    240
    300
    360
    411

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL2551 [new locus tag: SACOL_RS13355 ]
  • symbol: SACOL2551
  • description: hypothetical protein
  • length: 136
  • theoretical pI: 7.6635
  • theoretical MW: 15444.9
  • GRAVY: 0.0161765

Function[edit | edit source]

  • TIGRFAM:
    Unknown function General acyl-CoA thioester hydrolase, YbgC/YbaW family (TIGR00051; HMM-score: 42.9)
    and 1 more
    tol-pal system-associated acyl-CoA thioesterase (TIGR02799; EC 3.1.2.-; HMM-score: 26.3)
  • TheSEED  :
    • FIG01107953: hypothetical protein
  • PFAM:
    HotDog (CL0050) 4HBT_2; Thioesterase-like superfamily (PF13279; HMM-score: 75.9)
    and 2 more
    4HBT; Thioesterase superfamily (PF03061; HMM-score: 22.7)
    Acyl-ACP_TE_C; Acyl-ACP thioesterase C-terminal domain (PF20791; HMM-score: 17.3)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.9869
    • Cytoplasmic Membrane Score: 0.0118
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.0012
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.001366
    • TAT(Tat/SPI): 0.000103
    • LIPO(Sec/SPII): 0.000339
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTTEGLLVAEKEIEVNGYDIDAMGVVSNIVYIRWFEDLRTAFINQHMNYSTMINQGISPILMKTEAEYKVPVTIHDKPVGRIYLVKASKMKWVFQFEIVSAHGVHCIGTQTGGFYRLSDKKITSVPQVFQDILATK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas
  • protein localization: Cytoplasmic [1] [2] [3]
  • quantitative data / protein copy number per cell: 137 [4]
  • interaction partners:

Expression & Regulation[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

  1. Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
    A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
    PLoS One: 2009, 4(12);e8176
    [PubMed:19997597] [WorldCat.org] [DOI] (I e)
  2. Kristina Hempel, Florian-Alexander Herbst, Martin Moche, Michael Hecker, Dörte Becher
    Quantitative proteomic view on secreted, cell surface-associated, and cytoplasmic proteins of the methicillin-resistant human pathogen Staphylococcus aureus under iron-limited conditions.
    J Proteome Res: 2011, 10(4);1657-66
    [PubMed:21323324] [WorldCat.org] [DOI] (I p)
  3. Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
    The Staphylococcus aureus proteome.
    Int J Med Microbiol: 2014, 304(2);110-20
    [PubMed:24439828] [WorldCat.org] [DOI] (I p)
  4. Daniela Zühlke, Kirsten Dörries, Jörg Bernhardt, Sandra Maaß, Jan Muntel, Volkmar Liebscher, Jan Pané-Farré, Katharina Riedel, Michael Lalk, Uwe Völker, Susanne Engelmann, Dörte Becher, Stephan Fuchs, Michael Hecker
    Costs of life - Dynamics of the protein inventory of Staphylococcus aureus during anaerobiosis.
    Sci Rep: 2016, 6;28172
    [PubMed:27344979] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]