From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01510 [old locus tag: SACOL0299 ]
  • pan locus tag?: SAUPAN001221000
  • symbol: SACOL_RS01510
  • pan gene symbol?:
  • synonym:
  • product: cystatin-like fold lipoprotein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01510 [old locus tag: SACOL0299 ]
  • symbol: SACOL_RS01510
  • product: cystatin-like fold lipoprotein
  • replicon: chromosome
  • strand: +
  • coordinates: 333640..334014
  • length: 375
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (333640..334014) NCBI
  • BioCyc: SACOL_RS01510 BioCyc
  • MicrobesOnline: see SACOL0299

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    ATGAAAAGAATATTGGTAGTATTTTTAATGTTAGCAATTATATTGGCAGGTTGTTCTAAT
    AAAGGTGAAAAGTATCAAAAAGATATTGATAAAGTGTACAAAGAACAGAATCAAATGAAT
    AAAATTGCCTCGAAAGTACAAAACACTATTAAAACAGACATTAAACAAGAAGACAGTAAT
    ACACATGTTTATAAAGATGGTAAAGTCATTGTTATTGGTATTCAATTATATAAAGATCGT
    GAAAAAATGTATTATTTCGCATATGAAATAAAAGATGGTAAGGCAGAGATTAATAGAGAA
    ATAGACCCAATTAAGTATATGAAAGACCATAAAGCAGATTATGAAGATGAAAATGTAGAA
    GTGGAAAAAGATTAA
    60
    120
    180
    240
    300
    360
    375

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS01510 [old locus tag: SACOL0299 ]
  • symbol: SACOL_RS01510
  • description: cystatin-like fold lipoprotein
  • length: 124
  • theoretical pI: 7.49053
  • theoretical MW: 14630.8
  • GRAVY: -0.770161

Function[edit | edit source]

  • TIGRFAM:
    Cell structure Cell envelope Surface structures pilus (Caulobacter type) biogenesis lipoprotein CpaD (TIGR02522; HMM-score: 13.3)
    Genetic information processing Mobile and extrachromosomal element functions Plasmid functions entry exclusion lipoprotein TrbK (TIGR04359; HMM-score: 12.6)
    Genetic information processing Protein fate Protein and peptide secretion and trafficking outer membrane assembly lipoprotein YfgL (TIGR03300; HMM-score: 11.1)
    Unknown function General TIGR00374 family protein (TIGR00374; HMM-score: 10.8)
  • TheSEED: see SACOL0299
  • PFAM:
    NTF2 (CL0051) DUF4467; Domain of unknown function with cystatin-like fold (DUF4467) (PF14729; HMM-score: 125.5)
    and 8 more
    OB (CL0021) tRNA_anti-like; tRNA_anti-like (PF12869; HMM-score: 17.5)
    Lysozyme (CL0037) SLT_4; Transglycosylase SLT domain (PF19489; HMM-score: 15.8)
    LppaM (CL0421) LPAM_1; Prokaryotic membrane lipoprotein lipid attachment site (PF08139; HMM-score: 15.3)
    no clan defined NusG_II; NusG domain II (PF07009; HMM-score: 14.5)
    SLATT (CL0676) SLATT_6; SMODS and SLOG-associating 2TM effector domain 6 (PF18169; HMM-score: 14.5)
    no clan defined DUF4995; Domain of unknown function (PF16386; HMM-score: 13.1)
    DUF6491; Family of unknown function (DUF6491) (PF20101; HMM-score: 12.9)
    DUF7537; Family of unknown function (DUF7537) (PF24381; HMM-score: 12.5)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.7571
    • Cell wall & surface Score: 0.0023
    • Extracellular Score: 0.2406
  • LocateP:
  • SignalP: Signal peptide LIPO(Sec/SPII) length 17 aa
    • SP(Sec/SPI): 0.000302
    • TAT(Tat/SPI): 0.00005
    • LIPO(Sec/SPII): 0.999447
    • Cleavage Site: CS pos: 17-18. LAG-CS. Pr: 1.0000
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MKRILVVFLMLAIILAGCSNKGEKYQKDIDKVYKEQNQMNKIASKVQNTIKTDIKQEDSNTHVYKDGKVIVIGIQLYKDREKMYYFAYEIKDGKAEINREIDPIKYMKDHKADYEDENVEVEKD

Experimental data[edit | edit source]

  • experimentally validated: see SACOL0299
  • protein localization: see SACOL0299
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]