From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR375704-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS01675 [old locus tag: SACOL0333 ]
  • pan locus tag?: SAUPAN001309000
  • symbol: SACOL_RS01675
  • pan gene symbol?:
  • synonym:
  • product: helix-turn-helix domain-containing protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS01675 [old locus tag: SACOL0333 ]
  • symbol: SACOL_RS01675
  • product: helix-turn-helix domain-containing protein
  • replicon: chromosome
  • strand: +
  • coordinates: 361695..361958
  • length: 264
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (361695..361958) NCBI
  • BioCyc: SACOL_RS01675 BioCyc
  • MicrobesOnline: see SACOL0333

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGCCAAAAATCATAGTACCACCAACACCAGAAAACACATATAGAGGCGAAGAAAAATTT
    GTGAAAAAGTTATACGCAACACCTACACAAATCCACCAATTATTCGGAGTATGTAGAAGT
    ACCGTATACAACTGGTTGAAATATTACCGTGAAGATAATTTAGGTGTAGAAAATTTATAC
    ATTGATTATTCACCAACGGGAACATTGATTAATATTTCTAAATTAGAAGAGTATTTGATC
    AGAAAGCATAAAAAATGGTATTAG
    60
    120
    180
    240
    264

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS01675 [old locus tag: SACOL0333 ]
  • symbol: SACOL_RS01675
  • description: helix-turn-helix domain-containing protein
  • length: 87
  • theoretical pI: 9.49237
  • theoretical MW: 10445
  • GRAVY: -0.606897

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0333
  • PFAM:
    HTH (CL0123) HTH_23; Homeodomain-like domain (PF13384; HMM-score: 30.5)
    and 9 more
    HTH_29; Winged helix-turn helix (PF13551; HMM-score: 23.2)
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 22.4)
    HTH_Tnp_IS630; Transposase (PF01710; HMM-score: 17)
    Terminase_5; Putative ATPase subunit of terminase (gpP-like) (PF06056; HMM-score: 17)
    HTH_OrfB_IS605; Helix-turn-helix domain (PF12323; HMM-score: 17)
    HTH_17; Helix-turn-helix domain (PF12728; HMM-score: 16.3)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 13.4)
    HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 12.8)
    Phage_AlpA; Prophage CP4-57 regulatory protein (AlpA) (PF05930; HMM-score: 12)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.009293
    • TAT(Tat/SPI): 0.000382
    • LIPO(Sec/SPII): 0.000986
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MPKIIVPPTPENTYRGEEKFVKKLYATPTQIHQLFGVCRSTVYNWLKYYREDNLGVENLYIDYSPTGTLINISKLEEYLIRKHKKWY

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]