From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02080 [old locus tag: SACOL0413 ]
  • pan locus tag?: SAUPAN001881000
  • symbol: SACOL_RS02080
  • pan gene symbol?:
  • synonym:
  • product: RimJ/RimL family protein N-acetyltransferase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS02080 [old locus tag: SACOL0413 ]
  • symbol: SACOL_RS02080
  • product: RimJ/RimL family protein N-acetyltransferase
  • replicon: chromosome
  • strand: +
  • coordinates: 419132..419677
  • length: 546
  • essential: unknown

Accession numbers[edit | edit source]

  • Location: NC_002951 (419132..419677) NCBI
  • BioCyc: G1G4B-432 BioCyc
  • MicrobesOnline:

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGTTTGGAATGAAAGTGAATGAACAAATAACATTAAAAATTTTAGAAGCTCATGACACA
    GAAGCGCTTTTCAATTTAGTCAATCGTTCAAGAAATTCACTTAGGGAATGGTTACCTTGG
    GTAGATGCAACTGAGCAACCATCAGATACGCGTGCATTTATTAAAAGAGGACTTTTGCAA
    TTTGCTGATGGTAATGGATTTCAGTGTGGCATTTGGTATGAAGGAACGCTAGTTGGTGTC
    ATCGGTTTACATGAAATTAATCACATGCACAGAAAAACTTCATTAGGGTACTATTTAGAT
    AAAGAATTTGAGGGTCATGGGATTATGACACAAGCAGTTGAGGCATTGATAAAGTATTGT
    TTCGAAGAGCTTGACTTAAACCGAATTGAGATTAGTGCCGCAGTTAATAATGAAAAAAGC
    CGGGCTATTCCTGAAAGGCTGGGATTTACTAGAGAAGGTATGTTACGTGACAATGAATTA
    CTAAATGGTATTTATTCATCGAGTTACATCTATAGTTTATTAAAATCAGAATACGACCAA
    AAATGA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    546

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS02080 [old locus tag: SACOL0413 ]
  • symbol: SACOL_RS02080
  • description: RimJ/RimL family protein N-acetyltransferase
  • length: 181
  • theoretical pI: 5.32637
  • theoretical MW: 20856.5
  • GRAVY: -0.366851

Function[edit | edit source]

  • TIGRFAM:
    UDP-4-amino-4,6-dideoxy-N-acetyl-beta-L-altrosamine N-acetyltransferase (TIGR03585; EC 2.3.1.202; HMM-score: 43.3)
    and 2 more
    Cellular processes Cellular processes Toxin production and resistance aminoglycoside N(6')-acetyltransferase, AacA4 family (TIGR04431; EC 2.3.1.82; HMM-score: 21)
    Genetic information processing Protein synthesis Ribosomal proteins: synthesis and modification ribosomal-protein-alanine acetyltransferase (TIGR01575; EC 2.3.1.128; HMM-score: 13.5)
  • TheSEED:
  • PFAM:
    Acetyltrans (CL0257) Acetyltransf_3; Acetyltransferase (GNAT) domain (PF13302; HMM-score: 88.9)
    and 5 more
    Acetyltransf_1; Acetyltransferase (GNAT) family (PF00583; HMM-score: 50.2)
    Acetyltransf_4; Acetyltransferase (GNAT) domain (PF13420; HMM-score: 40.8)
    Acetyltransf_8; Acetyltransferase (GNAT) domain (PF13523; HMM-score: 27.3)
    Acetyltransf_10; Acetyltransferase (GNAT) domain (PF13673; HMM-score: 19.8)
    FR47; FR47-like protein (PF08445; HMM-score: 13.4)

Structure, modifications & interactions[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.012131
    • TAT(Tat/SPI): 0.000305
    • LIPO(Sec/SPII): 0.000752
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

  • GI: 446389797 NCBI
  • RefSeq: WP_000467652 NCBI
  • UniProt:

Protein sequence[edit | edit source]

  • MFGMKVNEQITLKILEAHDTEALFNLVNRSRNSLREWLPWVDATEQPSDTRAFIKRGLLQFADGNGFQCGIWYEGTLVGVIGLHEINHMHRKTSLGYYLDKEFEGHGIMTQAVEALIKYCFEELDLNRIEISAAVNNEKSRAIPERLGFTREGMLRDNELLNGIYSSSYIYSLLKSEYDQK

Experimental data[edit | edit source]

  • experimentally validated: no data available

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]