Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS02245 [old locus tag: SACOL0445 ]
- pan locus tag?: SAUPAN001972000
- symbol: SACOL_RS02245
- pan gene symbol?: —
- synonym:
- product: transcriptional regulator
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS02245 [old locus tag: SACOL0445 ]
- symbol: SACOL_RS02245
- product: transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 448197..448460
- length: 264
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAATATGCATATTTTATATAACTTACGAACTAAACATAATTTAGAAATTGACGAATTA
GCACAGCAATTAAATGAGAAATATGGTACTAAATATGAAGCACATCAAATTTGGGAATGG
GAGAATCATCACCATGAACCTAAATTTAAAGATGCCATGCATTTAGCTGACTTCTTTGAT
GCACCATATGAAATGTTTTTAGAAAGTAAGGTTAAAGAATATCAGAAACATTTAGAAGAA
GTCGATATTCGCATGGATAAATAG60
120
180
240
264
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS02245 [old locus tag: SACOL0445 ]
- symbol: SACOL_RS02245
- description: transcriptional regulator
- length: 87
- theoretical pI: 5.79476
- theoretical MW: 10789.1
- GRAVY: -1.05517
⊟Function[edit | edit source]
- TIGRFAM: Protein synthesis tRNA and rRNA base modification 23S rRNA (adenine(2503)-C(2))-methyltransferase (TIGR00048; EC 2.1.1.192; HMM-score: 12.4)
- TheSEED: see SACOL0445
- PFAM: HTH (CL0123) HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 16.9)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9905
- Cytoplasmic Membrane Score: 0.0041
- Cell wall & surface Score: 0.0004
- Extracellular Score: 0.005
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.003396
- TAT(Tat/SPI): 0.00014
- LIPO(Sec/SPII): 0.00035
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.