From AureoWiki
Jump to navigation Jump to search

NCBI: 10-JUN-2013

Summary[edit | edit source]

  • organism: Staphylococcus aureus USA300_FPR3757
  • locus tag: SAUSA300_0373 [new locus tag: SAUSA300_RS01985 ]
  • pan locus tag?: SAUPAN001972000
  • symbol: SAUSA300_0373
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAUSA300_0373 [new locus tag: SAUSA300_RS01985 ]
  • symbol: SAUSA300_0373
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 424276..424539
  • length: 264
  • essential: unknown other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGAATATGCATATTTTATATAACTTACGAACTAAACATAATTTAGAAATTGACGAATTA
    GCACAGCAATTAAATGAGAAATATGGTACTAAATATGAAGCACATCAAATTTGGGAATGG
    GAGAATCATCACCATGAACCTAAATTTAAAGATGCCATGCATTTAGCTGACTTCTTTGAT
    GCACCATATGAAATGTTTTTAGAAAGTAAGGTTAAAGAATATCAGAAACATTTAGAAGAA
    GTCGATATTCGCATGGATAAATAG
    60
    120
    180
    240
    264

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAUSA300_0373 [new locus tag: SAUSA300_RS01985 ]
  • symbol: SAUSA300_0373
  • description: hypothetical protein
  • length: 87
  • theoretical pI: 5.79476
  • theoretical MW: 10789.1
  • GRAVY: -1.05517

Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein synthesis tRNA and rRNA base modification 23S rRNA (adenine(2503)-C(2))-methyltransferase (TIGR00048; EC 2.1.1.192; HMM-score: 12.4)
  • TheSEED  :
    • FIG01107864: hypothetical protein
  • PFAM:
    HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 11.8)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003396
    • TAT(Tat/SPI): 0.00014
    • LIPO(Sec/SPII): 0.00035
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MNMHILYNLRTKHNLEIDELAQQLNEKYGTKYEAHQIWEWENHHHEPKFKDAMHLADFFDAPYEMFLESKVKEYQKHLEEVDIRMDK

Experimental data[edit | edit source]

  • experimentally validated: data available for COL, NCTC8325
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell: data available for COL
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]