From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS02350 [old locus tag: SACOL0464 ]
  • pan locus tag?: SAUPAN002057000
  • symbol: SACOL_RS02350
  • pan gene symbol?:
  • synonym:
  • product: transposase

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS02350 [old locus tag: SACOL0464 ]
  • symbol: SACOL_RS02350
  • product: transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 467453..467725
  • length: 273
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (467453..467725) NCBI
  • BioCyc: SACOL_RS02350 BioCyc
  • MicrobesOnline: see SACOL0464

Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    ATGACAAAAGAAAGAAGAACATTTAGTTCAGAGTTTAAGTTACAAATGGTTAGATTATAT
    AAAAATGGTAAGCTTAAGAATGAAATTATACGAAAGTATGATTTAAAACCCTCAATTATC
    TCAAATTCGATAAAACAACACCAAAATACTGGACCCTTCAATCATCAAGATAATTTAAAA
    AGTGATGAAAAAGAGTTAATAAAATTACGCAAAGAAGTTCAACATTTAAAAATGGAACAT
    GATGTTTTAAAGCAAATTTTAAAGTTGATTTAG
    60
    120
    180
    240
    273

Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS02350 [old locus tag: SACOL0464 ]
  • symbol: SACOL_RS02350
  • description: transposase
  • length: 90
  • theoretical pI: 10.6672
  • theoretical MW: 10830.6
  • GRAVY: -0.925556

Function[edit | edit source]

  • TIGRFAM:
  • TheSEED: see SACOL0464
  • PFAM:
    HTH (CL0123) HTH_Tnp_1; Transposase (PF01527; HMM-score: 30.4)
    and 7 more
    HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 18)
    CENP-B_N; CENP-B N-terminal DNA-binding domain (PF04218; HMM-score: 15.9)
    no clan defined DUF7491; Coiled-coil region of unknown function (DUF7491) (PF24319; HMM-score: 15.6)
    YqfI; YqfI-like (PF23690; HMM-score: 14.3)
    REST_helical; Helical region in REST corepressor (PF20878; HMM-score: 13.9)
    DUF7237; Family of unknown function (DUF7237) (PF23884; HMM-score: 13.3)
    HTH (CL0123) BrkDBD; Brinker DNA-binding domain (PF09607; HMM-score: 13.1)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.73
    • Cytoplasmic Membrane Score: 0.0164
    • Cell wall & surface Score: 0.0005
    • Extracellular Score: 0.253
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004697
    • TAT(Tat/SPI): 0.000704
    • LIPO(Sec/SPII): 0.001941
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Protein sequence[edit | edit source]

  • MTKERRTFSSEFKLQMVRLYKNGKLKNEIIRKYDLKPSIISNSIKQHQNTGPFNHQDNLKSDEKELIKLRKEVQHLKMEHDVLKQILKLI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization: see SACOL0464
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Other Information[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

Relevant publications[edit | edit source]