From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS03015 [old locus tag: SACOL0581 ]
  • pan locus tag?: SAUPAN002304000
  • symbol: SACOL_RS03015
  • pan gene symbol?: secE
  • synonym:
  • product: protein translocase subunit SecE

⊟Additional information (user-provided)[edit | edit source]

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS03015 [old locus tag: SACOL0581 ]
  • symbol: SACOL_RS03015
  • product: protein translocase subunit SecE
  • replicon: chromosome
  • strand: +
  • coordinates: 602561..602743
  • length: 183
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (602561..602743) NCBI
  • BioCyc: SACOL_RS03015 BioCyc
  • MicrobesOnline: see SACOL0581

⊟Phenotype[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    ATGGCTAAAAAAGAAAGTTTCTTTAAAGGCGTTAAGTCTGAAATGGAAAAAACAAGTTGG
    CCGACGAAAGAAGAGCTATTTAAATATACTGTAATTGTAGTTTCTACTGTTATATTCTTC
    TTAGTCTTTTTCTATGCCTTAGATTTAGGAATTACAGCATTGAAAAATTTATTATTTCGT
    TAG
    60
    120
    180
    183


⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS03015 [old locus tag: SACOL0581 ]
  • symbol: SACOL_RS03015
  • description: protein translocase subunit SecE
  • length: 60
  • theoretical pI: 10.0161
  • theoretical MW: 7031.36
  • GRAVY: 0.401667

⊟Function[edit | edit source]

  • TIGRFAM:
    Genetic information processing Protein fate Protein and peptide secretion and trafficking preprotein translocase, SecE subunit (TIGR00964; HMM-score: 75.8)
    and 1 more
    HAD ATPase, P-type, family IC (TIGR01494; EC 3.6.3.-; HMM-score: 11.8)
  • TheSEED: see SACOL0581
  • PFAM:
    no clan defined SecE; SecE/Sec61-gamma subunits of protein translocation complex (PF00584; HMM-score: 70)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.998
    • Cell wall & surface Score: 0
    • Extracellular Score: 0.002
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.003795
    • TAT(Tat/SPI): 0.000127
    • LIPO(Sec/SPII): 0.001823
  • predicted transmembrane helices (TMHMM): 1

⊟Accession numbers[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MAKKESFFKGVKSEMEKTSWPTKEELFKYTVIVVSTVIFFLVFFYALDLGITALKNLLFR

⊟Experimental data[edit | edit source]

  • experimentally validated: data available for NCTC8325
  • protein localization: see SACOL0581
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Additional information (user-provided)[edit | edit source]

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Additional information (user-provided)[edit | edit source]

⊟Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

⊟Literature[edit | edit source]

⊟References[edit | edit source]


⊟Relevant publications[edit | edit source]