Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04135 [old locus tag: SACOL0804 ]
- pan locus tag?: SAUPAN002647000
- symbol: SACOL_RS04135
- pan gene symbol?: brxC
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04135 [old locus tag: SACOL0804 ]
- symbol: SACOL_RS04135
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 826825..827145
- length: 321
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301GTGGCTATAAAGCTAAGTTCAATTGACCAATTTGAACAGGTTATTGAGGAAAATAAATAT
GTTTTTGTATTAAAACATAGTGAAACTTGTCCAATATCGGCAAATGCGTACGATCAATTT
AATAAATTTTTATATGAACGCGATATGGACGGTTATTATTTGATTGTCCAACAAGAACGC
GATTTGTCAGATTATATTGCTAAAAAAACGAACGTTAAACATGAATCACCTCAAGCATTT
TATTTTGTAAATGGTGAAATGGTTTGGAATCGAGACCACGGTGATATCAATGTGTCGTCA
TTAGCACAAGCAGAAGAATAA60
120
180
240
300
321
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04135 [old locus tag: SACOL0804 ]
- symbol: SACOL_RS04135
- description: hypothetical protein
- length: 106
- theoretical pI: 4.44331
- theoretical MW: 12436.8
- GRAVY: -0.557547
⊟Function[edit | edit source]
- TIGRFAM: Unknown function Enzymes of unknown specificity bacillithiol system protein YtxJ (TIGR04019; HMM-score: 111.4)
- TheSEED: see SACOL0804
- PFAM: Thioredoxin (CL0172) BrxC; Monothiol bacilliredoxin BrxC (PF11009; HMM-score: 114.6)and 4 moreno clan defined HHA; Haemolysin expression modulating protein (PF05321; HMM-score: 15.7)GBD (CL0202) CBM_11; Carbohydrate binding domain (family 11) (PF03425; HMM-score: 14.4)no clan defined HI_0552; HI_0552 protein family (PF10786; HMM-score: 14.4)DUF2977; Protein of unknown function (DUF2977) (PF11192; HMM-score: 14.2)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9543
- Cytoplasmic Membrane Score: 0.0099
- Cell wall & surface Score: 0.0026
- Extracellular Score: 0.0332
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.005812
- TAT(Tat/SPI): 0.000316
- LIPO(Sec/SPII): 0.000877
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MAIKLSSIDQFEQVIEENKYVFVLKHSETCPISANAYDQFNKFLYERDMDGYYLIVQQERDLSDYIAKKTNVKHESPQAFYFVNGEMVWNRDHGDINVSSLAQAEE
⊟Experimental data[edit | edit source]
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]