Jump to navigation
Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS04580 [old locus tag: SACOL0892 ]
- pan locus tag?: SAUPAN002849000
- symbol: SACOL_RS04580
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS04580 [old locus tag: SACOL0892 ]
- symbol: SACOL_RS04580
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 908049..908321
- length: 273
- essential: unknown
⊟Accession numbers[edit | edit source]
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGTCTAGAACAAAATTGCATGATGTACCAGCTAAAGAAAATACAATTACAGAACCAAAG
CAAGTTGTAGTGAATCCTTTGTTTGCGAAACCTAATGCACTAGCTAGTATTTTTGGAATT
TCATATAGTTCGGTGAATCGCATTTTAAAAGAATGGGAAAAAGATTCTAAAGGTGTTGAT
GATTTATATTACTCGTTATCATCAACAATGATTGTTATAAGTATTCCACGATTCGAGGAG
TACATGAAGGCACGTCATAAAAAATGGATGTAG60
120
180
240
273
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS04580 [old locus tag: SACOL0892 ]
- symbol: SACOL_RS04580
- description: hypothetical protein
- length: 90
- theoretical pI: 9.97772
- theoretical MW: 10405
- GRAVY: -0.375556
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: data available for USA300_FPR3757
- PFAM: HTH (CL0123) HTH_Tnp_4; Helix-turn-helix of DDE superfamily endonuclease (PF13613; HMM-score: 18.9)HTH_Crp_2; Crp-like helix-turn-helix domain (PF13545; HMM-score: 18.8)HTH_23; Homeodomain-like domain (PF13384; HMM-score: 18.7)HTH_28; Helix-turn-helix domain (PF13518; HMM-score: 15.4)and 3 moreMarR_2; MarR family (PF12802; HMM-score: 14.3)HTH_Tnp_ISL3; Helix-turn-helix domain of transposase family ISL3 (PF13542; HMM-score: 13.8)HTH_29; Winged helix-turn helix (PF13551; HMM-score: 13.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.9723
- Cytoplasmic Membrane Score: 0.0047
- Cell wall & surface Score: 0.0005
- Extracellular Score: 0.0225
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.010779
- TAT(Tat/SPI): 0.001266
- LIPO(Sec/SPII): 0.000941
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MSRTKLHDVPAKENTITEPKQVVVNPLFAKPNALASIFGISYSSVNRILKEWEKDSKGVDDLYYSLSSTMIVISIPRFEEYMKARHKKWM
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: no data available
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You can add further information about the gene and protein here. [edit]