From AureoWiki
Jump to navigation Jump to search
PangenomeCOLN315NCTC8325NewmanUSA300_FPR3757JSNZ04-0298108BA0217611819-97685071193ECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50RF122ST398T0131TCH60TW20USA300_TCH1516VC40

NCBI: 02-MAR-2017

Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS11525 [old locus tag: SACOL2191 ]
  • pan locus tag?: SAUPAN005605000
  • symbol: SACOL_RS11525
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS11525 [old locus tag: SACOL2191 ]
  • symbol: SACOL_RS11525
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2272139..2272264
  • length: 126
  • essential: unknown other strains

Accession numbers[edit | edit source]

  • Location: NC_002951 (2272139..2272264) NCBI
  • BioCyc: SACOL_RS11525 BioCyc
  • MicrobesOnline: see SACOL2191

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    ATGAGATATATACACTTTTCTATTATTACATTAATTACAGGTATCATTATGCATATTACA
    ATGTACTTTGTACCATTTGAATCTCGGAAAATGCCACTATTTATGACGATAATTTTTACA
    ATCTAA
    60
    120
    126


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SACOL_RS11525 [old locus tag: SACOL2191 ]
  • symbol: SACOL_RS11525
  • description: hypothetical protein
  • length: 41
  • theoretical pI: 10.0069
  • theoretical MW: 4968.16
  • GRAVY: 1.12683

Function[edit | edit source]

  • TIGRFAM:
    Hypothetical proteins Conserved conserved hypothetical protein (TIGR01655; HMM-score: 10.3)
  • TheSEED: see SACOL2191
  • PFAM:

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

Localization[edit | edit source]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helix: 1
  • DeepLocPro: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.0005
    • Cytoplasmic Membrane Score: 0.9695
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.03
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.100445
    • TAT(Tat/SPI): 0.000955
    • LIPO(Sec/SPII): 0.031459
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MRYIHFSIITLITGIIMHITMYFVPFESRKMPLFMTIIFTI

Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator:

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]


Relevant publications[edit | edit source]