Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL2191 [new locus tag: SACOL_RS11525 ]
- pan locus tag?: SAUPAN005605000
- symbol: SACOL2191
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL2191 [new locus tag: SACOL_RS11525 ]
- symbol: SACOL2191
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2272139..2272264
- length: 126
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3238091 NCBI
- RefSeq: YP_187002 NCBI
- BioCyc: see SACOL_RS11525
- MicrobesOnline: 913676 MicrobesOnline
⊟Phenotype[edit | edit source]
Share your knowledge and add information here. [edit]
⊟DNA sequence[edit | edit source]
- 1
61
121ATGAGATATATACACTTTTCTATTATTACATTAATTACAGGTATCATTATGCATATTACA
ATGTACTTTGTACCATTTGAATCTCGGAAAATGCCACTATTTATGACGATAATTTTTACA
ATCTAA60
120
126
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL2191 [new locus tag: SACOL_RS11525 ]
- symbol: SACOL2191
- description: hypothetical protein
- length: 41
- theoretical pI: 10.0069
- theoretical MW: 4968.16
- GRAVY: 1.12683
⊟Function[edit | edit source]
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0005
- Cytoplasmic Membrane Score: 0.9695
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.03
- LocateP: N-terminally anchored (No CS)
- Prediction by SwissProt Classification: Membrane
- Pathway Prediction: Sec-(SPI)
- Intracellular possibility: 0.17
- Signal peptide possibility: -1
- N-terminally Anchored Score: 4
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.100445
- TAT(Tat/SPI): 0.000955
- LIPO(Sec/SPII): 0.031459
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Protein sequence[edit | edit source]
- MRYIHFSIITLITGIIMHITMYFVPFESRKMPLFMTIIFTI
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator:
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Other Information[edit | edit source]
You are kindly invited to share additional interesting facts.