From AureoWiki
Jump to navigation Jump to search

NCBI: 02-MAR-2017

⊟Summary[edit | edit source]

  • organism: Staphylococcus aureus COL
  • locus tag: SACOL_RS13070 [old locus tag: SACOL2495 ]
  • pan locus tag?: SAUPAN006070000
  • symbol: SACOL_RS13070
  • pan gene symbol?: —
  • synonym:
  • product: hypothetical protein

⊟Genome View[edit | edit source]

⊟Gene[edit | edit source]

⊟General[edit | edit source]

  • type: CDS
  • locus tag: SACOL_RS13070 [old locus tag: SACOL2495 ]
  • symbol: SACOL_RS13070
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2547516..2547842
  • length: 327
  • essential: unknown other strains

⊟Accession numbers[edit | edit source]

  • Location: NC_002951 (2547516..2547842) NCBI
  • BioCyc: SACOL_RS13070 BioCyc
  • MicrobesOnline: see SACOL2495

⊟Phenotype[edit | edit source]

Share your knowledge and add information here. [edit]

⊟DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    ATGTTTACTACGTATAAAAATATTAATGAACTTGAAAATGCCTATGATGAAGAAAGAAAA
    CAATTGAATGATGCATTCAATCAAATTGATGAATTAAGACATCAAACACGCAAGAAATGT
    GAACAAATGTATGATCATTTCTTATATCTCAAACATAAAATGAATTATAGTGAAGACGCT
    ATGATCAGGATGACACGTATTATAGAATCTTTCGATAGAGAAACGAATCAACGTATCCGA
    CATCACGAAATGAAATTAGAAGATTATAAAGATGAGTTAAGAAGAGAATATCTAAAACAA
    TCTGACAGAATTGAAGGAGATGAATAA
    60
    120
    180
    240
    300
    327

⊟Protein[edit | edit source]

⊟General[edit | edit source]

  • locus tag: SACOL_RS13070 [old locus tag: SACOL2495 ]
  • symbol: SACOL_RS13070
  • description: hypothetical protein
  • length: 108
  • theoretical pI: 5.63959
  • theoretical MW: 13586.1
  • GRAVY: -1.45

⊟Function[edit | edit source]

  • TIGRFAM:
    two transmembrane protein (TIGR04527; HMM-score: 9.7)
    and 3 more
    Genetic information processing DNA metabolism Degradation of DNA exodeoxyribonuclease VII, large subunit (TIGR00237; EC 3.1.11.6; HMM-score: 7.2)
    Genetic information processing Protein fate Protein folding and stabilization chaperone protein DnaK (TIGR02350; HMM-score: 6.9)
    variant surface antigen, rifin family (TIGR01477; HMM-score: 5.3)
  • TheSEED: see SACOL2495
  • PFAM:
    VPS23_C (CL0596) Mod_r; Modifier of rudimentary (Mod(r)) protein (PF07200; HMM-score: 15.7)
    no clan defined Jnk-SapK_ap_N; JNK_SAPK-associated protein-1 (PF09744; HMM-score: 15.4)
    AATF-Che1; Apoptosis antagonizing transcription factor (PF13339; HMM-score: 13.6)
    Exonuc_VII_L; Exonuclease VII, large subunit (PF02601; HMM-score: 12.8)
    and 9 more
    HUP (CL0039) CDPS; Cyclodipeptide synthase (PF16715; HMM-score: 11.9)
    no clan defined DUF1043; Protein of unknown function (DUF1043) (PF06295; HMM-score: 11.6)
    SWIRM-assoc_1; SWIRM-associated region 1 (PF16495; HMM-score: 11.6)
    Fib_alpha; Fibrinogen alpha/beta chain family (PF08702; HMM-score: 10.8)
    Spc24; Spc24 subunit of Ndc80 (PF08286; HMM-score: 10.7)
    DUF4407; Domain of unknown function (DUF4407) (PF14362; HMM-score: 10.2)
    V_ATPase_I; V-type ATPase 116kDa subunit family (PF01496; HMM-score: 7.7)
    FliD_C; Flagellar hook-associated protein 2 C-terminus (PF07195; HMM-score: 7.4)
    FapA; Flagellar Assembly Protein A (PF03961; HMM-score: 6.5)

⊟Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effectors:

⊟Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP:
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.004856
    • TAT(Tat/SPI): 0.000517
    • LIPO(Sec/SPII): 0.001212
  • predicted transmembrane helices (TMHMM): 0

⊟Accession numbers[edit | edit source]

⊟Protein sequence[edit | edit source]

  • MFTTYKNINELENAYDEERKQLNDAFNQIDELRHQTRKKCEQMYDHFLYLKHKMNYSEDAMIRMTRIIESFDRETNQRIRHHEMKLEDYKDELRREYLKQSDRIEGDE

⊟Experimental data[edit | edit source]

  • experimentally validated:
  • protein localization:
  • quantitative data / protein copy number per cell:
  • interaction partners:

⊟Expression & Regulation[edit | edit source]

⊟Operon[edit | edit source]

⊟Regulation[edit | edit source]

  • regulator:

⊟Transcription pattern[edit | edit source]

⊟Protein synthesis (provided by Aureolib)[edit | edit source]

⊟Protein stability[edit | edit source]

  • half-life: no data available

⊟Biological Material[edit | edit source]

⊟Mutants[edit | edit source]

⊟Expression vector[edit | edit source]

⊟lacZ fusion[edit | edit source]

⊟GFP fusion[edit | edit source]

⊟two-hybrid system[edit | edit source]

⊟FLAG-tag construct[edit | edit source]

⊟Antibody[edit | edit source]

⊟Other Information[edit | edit source]

You are kindly invited to share additional interesting facts.

⊟Literature[edit | edit source]

⊟References[edit | edit source]

⊟Relevant publications[edit | edit source]

Retrieved from "http://aureowiki.med.uni-greifswald.de/index.php?title=SACOL_RS13070&oldid=93134"