Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS13110 [old locus tag: SACOL2502 ]
- pan locus tag?: SAUPAN006092000
- symbol: SACOL_RS13110
- pan gene symbol?: scrA
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS13110 [old locus tag: SACOL2502 ]
- symbol: SACOL_RS13110
- product: hypothetical protein
- replicon: chromosome
- strand: +
- coordinates: 2556603..2556869
- length: 267
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (2556603..2556869) NCBI
- BioCyc: SACOL_RS13110 BioCyc
- MicrobesOnline: see SACOL2502
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241ATGAAAGGCTCTAAACAAATACTTTTGATTATGGGCATTATATCTCTTATTGTTTTATTT
ATTTTTACACTATTCATCATGGCGCAATATGCAAAACATTATGAACAAAAATCCGACAGT
TCCAACGCACATACTTTAAATTCATCATCAGCCATAATTGAGCAACATACTATGTCGAAT
TTAGCGTCTCTAGATTTATACGCTCCTGTTCGTAACATTACTTCTAGTCGTGATATTCAT
CCCATTTATTTCATGACAAAAGATTAA60
120
180
240
267
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS13110 [old locus tag: SACOL2502 ]
- symbol: SACOL_RS13110
- description: hypothetical protein
- length: 88
- theoretical pI: 8.94062
- theoretical MW: 9964.55
- GRAVY: 0.176136
⊟Function[edit | edit source]
- TIGRFAM:
- TheSEED: see SACOL2502
- PFAM: TSPAN_4TM-like (CL0347) DUF4064; Protein of unknown function (DUF4064) (PF13273; HMM-score: 17.1)no clan defined SelK_SelG; Selenoprotein SelK_SelG (PF10961; HMM-score: 15.3)and 1 moreVpu; Vpu protein (PF00558; HMM-score: 12.5)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: unknown (no significant prediction)
- Cytoplasmic Score: 2.5
- Cytoplasmic Membrane Score: 2.5
- Cellwall Score: 2.5
- Extracellular Score: 2.5
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0.0007
- Cytoplasmic Membrane Score: 0.8903
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.1089
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.170297
- TAT(Tat/SPI): 0.002748
- LIPO(Sec/SPII): 0.027568
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MKGSKQILLIMGIISLIVLFIFTLFIMAQYAKHYEQKSDSSNAHTLNSSSAIIEQHTMSNLASLDLYAPVRNITSSRDIHPIYFMTKD
⊟Experimental data[edit | edit source]
- experimentally validated:
- protein localization:
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- data available for JSNZ
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]