Jump to navigation
Jump to search
NCBI: 02-MAR-2017
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
- pan locus tag?: SAUPAN006340000
- symbol: SACOL_RS13865
- pan gene symbol?: —
- synonym:
- product: hypothetical protein
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
- symbol: SACOL_RS13865
- product: hypothetical protein
- replicon: chromosome
- strand: -
- coordinates: 2707354..2707554
- length: 201
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Location: NC_002951 (2707354..2707554) NCBI
- BioCyc: SACOL_RS13865 BioCyc
- MicrobesOnline: see SACOL2647
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181ATGATACTAGTAATGTTATCTCCATTATTAATCATATTCTTTATAGTGTTGTCTATTTTA
GAAGAGCGTAAACGTACGAAGAAAAAGCAACTCGAGAAAGAAAAAGCAAATACACTAAAT
CAAAATACAAATGACACGGAAAGTTCAAATCAAGAGCCGTCATTGCAGCAGGATAAAGAA
CAAAAAGATAACAAAGGATAA60
120
180
201
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL_RS13865 [old locus tag: SACOL2647 ]
- symbol: SACOL_RS13865
- description: hypothetical protein
- length: 66
- theoretical pI: 9.17593
- theoretical MW: 7687.8
- GRAVY: -0.836364
⊟Function[edit | edit source]
- TIGRFAM: Cellular processes Adaptations to atypical conditions phage shock protein B (TIGR02976; HMM-score: 14)Cellular processes Sporulation and germination stage III sporulation protein AF (TIGR02896; HMM-score: 12.3)and 1 moreTransport and binding proteins Carbohydrates, organic alcohols, and acids D-galactonate transporter (TIGR00893; HMM-score: 10.1)
- TheSEED: see SACOL2647
- PFAM: no clan defined DUF4834; Domain of unknown function (DUF4834) (PF16118; HMM-score: 21.1)TMEM154; TMEM154 protein family (PF15102; HMM-score: 19.7)TMEM156; TMEM156 protein family (PF15106; HMM-score: 17)and 17 moreTransporter (CL0375) Connexin; Connexin (PF00029; HMM-score: 16.6)no clan defined Di19_C; Stress-induced protein Di19, C-terminal (PF14571; HMM-score: 16.1)Cadherin_C_2; Cadherin cytoplasmic C-terminal (PF16492; HMM-score: 15.5)Ctr; Ctr copper transporter family (PF04145; HMM-score: 15.2)TPR (CL0020) DUF6377; Domain of unknown function (DUF6377) (PF19904; HMM-score: 15.2)no clan defined GPR15L; G-protein coupled receptor ligand 15 (PF15854; HMM-score: 15)DUF6724; Family of unknown function (DUF6724) (PF20485; HMM-score: 14.8)PFF1_TM; Vacuolar membrane protease, transmembrane domain (PF22251; HMM-score: 14.5)DUF6249; Domain of unknown function (DUF6249) (PF19762; HMM-score: 13.1)GRP; Glycine rich protein family (PF07172; HMM-score: 12.6)YajC; Preprotein translocase subunit (PF02699; HMM-score: 12.4)MFS (CL0015) SLC52_ribofla_tr; Solute carrier family 52, riboflavin transporter (PF06237; HMM-score: 12.2)no clan defined MotB_plug; Membrane MotB of proton-channel complex MotA/MotB (PF13677; HMM-score: 12.1)MFS (CL0015) CLN3; CLN3 protein (PF02487; HMM-score: 12)no clan defined Piezo_TM1-24; Piezo TM1-24 (PF24871; HMM-score: 11.9)OAD_gamma; Oxaloacetate decarboxylase, gamma chain (PF04277; HMM-score: 11.6)GPCR_A (CL0192) SID-1_RNA_chan; dsRNA-gated channel SID-1 (PF13965; HMM-score: 10.6)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effectors:
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic Membrane
- Cytoplasmic Score: 0.32
- Cytoplasmic Membrane Score: 9.55
- Cellwall Score: 0.12
- Extracellular Score: 0.01
- Internal Helix: 1
- DeepLocPro: Cytoplasmic Membrane
- Cytoplasmic Score: 0
- Cytoplasmic Membrane Score: 0.9973
- Cell wall & surface Score: 0
- Extracellular Score: 0.0027
- LocateP:
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.257112
- TAT(Tat/SPI): 0.001775
- LIPO(Sec/SPII): 0.196041
- predicted transmembrane helices (TMHMM): 1
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MILVMLSPLLIIFFIVLSILEERKRTKKKQLEKEKANTLNQNTNDTESSNQEPSLQQDKEQKDNKG
⊟Experimental data[edit | edit source]
- experimentally validated: see SACOL2647
- protein localization: see SACOL2647
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
⊟Regulation[edit | edit source]
- regulator:
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]