From AureoWiki
Jump to navigation Jump to search

NCBI: 03-AUG-2016

Summary[edit | edit source]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_00234
  • pan locus tag?: SAUPAN001143000
  • symbol: SAOUHSC_00234
  • pan gene symbol?: bglR
  • synonym:
  • product: hypothetical protein

Additional information (user-provided)[edit | edit source]

Genome View[edit | edit source]

Gene[edit | edit source]

General[edit | edit source]

  • type: CDS
  • locus tag: SAOUHSC_00234
  • symbol: SAOUHSC_00234
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 255367..256071
  • length: 705
  • essential: no DEG other strains

Accession numbers[edit | edit source]

Phenotype[edit | edit source]

Additional information (user-provided)[edit | edit source]

DNA sequence[edit | edit source]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    TTGTTAAAGTATGAACATATTGCTAAGCAACTTAATGCGTTTATACATCAATCTAATTTC
    AAACCCGGTGATAAATTGCCAAGCGTGACGCAATTAAAAGAACGTTATCAAGTAAGTAAG
    AGTACTATCATTAAAGCATTAGGCTTATTGGAACAAGATGGTTTGATCTATCAAGCACAA
    GGCAGTGGTATTTATGTGAGAAATATTGCTGATGCCAATCGTATCAACGTCTTTAAGACT
    AATGGTTTCTCTAAAAGTTTAGGTGAACACCGAATGACAAGTAAGGTACTTGTTTTTAAG
    GAGATTGCAACGCCACCTAAATCTGTACAAGATGAGCTCCAATTAAATGCAGATGATACC
    GTCTACTATTTAGAGCGATTAAGATTCGTGGACGATGATGTTTTATGTATCGAATATTCT
    TATTATCATAAAGAAATCGTGAAATATTTAAATGATGATATTGCTAAGGGCTCTATCTTC
    GACTATTTAGAATCAAACATGAAACTTCGTATTGGTTTTTCAGATATTTTCTTTAATGTA
    GATCAACTCACTTCAAGTGAAGCTTCATTACTACAATTGTCTACAGGTGAACCATGTTTA
    CGTTACCACCAGACTTTTTATACAATGACTGGCAAACCCTTTGATTCATCTGACATCGTA
    TTTCATTATCGTCATGCACAGTTTTATATTCCTAGTAAAAAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    705


Protein[edit | edit source]

General[edit | edit source]

  • locus tag: SAOUHSC_00234
  • symbol: SAOUHSC_00234
  • description: hypothetical protein
  • length: 234
  • theoretical pI: 7.67897
  • theoretical MW: 27013.6
  • GRAVY: -0.359829

Function[edit | edit source]

  • TIGRFAM:
    Signal transduction Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 112.2)
    Signal transduction Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 90.1)
    and 10 more
    Metabolism Transport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    Signal transduction Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)
    Metabolism Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 66.7)
    Signal transduction Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 66.7)
    phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 27.8)
    Metabolism Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Metabolism Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transduction Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)
    Signal transduction Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.9)
    Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 12.1)
  • TheSEED  :
    • Transcriptional regulator, GntR family
  • PFAM:
    UTRA (CL0122) UTRA; UTRA domain (PF07702; HMM-score: 95.6)
    and 12 more
    HTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 61.1)
    HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 22.2)
    HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 21.9)
    HTH_11; HTH domain (PF08279; HMM-score: 17.1)
    MarR_2; MarR family (PF12802; HMM-score: 16.2)
    Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 15.4)
    TBPIP; TBPIP/Hop2 winged helix domain (PF07106; HMM-score: 15.2)
    DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 14.9)
    Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 14.7)
    MarR; MarR family (PF01047; HMM-score: 14.1)
    HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.9)
    RPA_C; Replication protein A C terminal (PF08784; HMM-score: 12.7)

Structure, modifications & cofactors[edit | edit source]

  • domains:
  • modifications:
  • cofactors:
  • effector: Beta-glucoside-6-phosphate
  • genes regulated by BglR*, TF important in Beta-glucosides utilizationRegPrecise
    repression
    transcription units transferred from N315 data RegPrecise

Localization[edit | edit source]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • DeepLocPro: Cytoplasmic
    • Cytoplasmic Score: 0.986
    • Cytoplasmic Membrane Score: 0.0071
    • Cell wall & surface Score: 0.0001
    • Extracellular Score: 0.0069
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular possibility: 1
    • Signal peptide possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • SP(Sec/SPI): 0.00433
    • TAT(Tat/SPI): 0.000361
    • LIPO(Sec/SPII): 0.000474
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit | edit source]

Additional information (user-provided)[edit | edit source]

Protein sequence[edit | edit source]

  • MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK

Experimental data[edit | edit source]

  • experimentally validated: PeptideAtlas [1] [2]
  • protein localization: data available for COL
  • quantitative data / protein copy number per cell:
  • interaction partners:

Expression & Regulation[edit | edit source]

Operon[edit | edit source]

Regulation[edit | edit source]

  • regulator: BglR* (repression) regulon
    BglR*(TF)important in Beta-glucosides utilization; RegPrecise 

Additional information (user-provided)[edit | edit source]

Transcription pattern[edit | edit source]

Protein synthesis (provided by Aureolib)[edit | edit source]

Protein stability[edit | edit source]

  • half-life: no data available

Biological Material[edit | edit source]

Mutants[edit | edit source]

Expression vector[edit | edit source]

lacZ fusion[edit | edit source]

GFP fusion[edit | edit source]

two-hybrid system[edit | edit source]

FLAG-tag construct[edit | edit source]

Antibody[edit | edit source]

Additional information (user-provided)[edit | edit source]

Other information (user-provided)[edit | edit source]

You can add further information about the gene and protein here. [edit]

Literature[edit | edit source]

References[edit | edit source]

  1. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-61
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  2. Stephan Michalik, Maren Depke, Annette Murr, Manuela Gesell Salazar, Ulrike Kusebauch, Zhi Sun, Tanja C Meyer, Kristin Surmann, Henrike Pförtner, Petra Hildebrandt, Stefan Weiss, Laura Marcela Palma Medina, Melanie Gutjahr, Elke Hammer, Dörte Becher, Thomas Pribyl, Sven Hammerschmidt, Eric W Deutsch, Samuel L Bader, Michael Hecker, Robert L Moritz, Ulrike Mäder, Uwe Völker, Frank Schmidt
    A global Staphylococcus aureus proteome resource applied to the in vivo characterization of host-pathogen interactions.
    Sci Rep: 2017, 7(1);9718
    [PubMed:28887440] [WorldCat.org] [DOI] (I e)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit | edit source]

Semen A Leyn, Marat D Kazanov, Natalia V Sernova, Ekaterina O Ermakova, Pavel S Novichkov, Dmitry A Rodionov
Genomic reconstruction of the transcriptional regulatory network in Bacillus subtilis.
J Bacteriol: 2013, 195(11);2463-73
[PubMed:23504016] [WorldCat.org] [DOI] (I p)