Jump to navigation
Jump to search
NCBI: 10-JUN-2013
⊟Summary[edit | edit source]
- organism: Staphylococcus aureus COL
- locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
- pan locus tag?: SAUPAN001143000
- symbol: SACOL0249
- pan gene symbol?: bglR
- synonym:
- product: GntR family transcriptional regulator
⊟Additional information (user-provided)[edit | edit source]
⊟Genome View[edit | edit source]
⊟Gene[edit | edit source]
⊟General[edit | edit source]
- type: CDS
- locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
- symbol: SACOL0249
- product: GntR family transcriptional regulator
- replicon: chromosome
- strand: -
- coordinates: 289279..289983
- length: 705
- essential: unknown other strains
⊟Accession numbers[edit | edit source]
- Gene ID: 3236684 NCBI
- RefSeq: YP_185145 NCBI
- BioCyc: see SACOL_RS01260
- MicrobesOnline: 911723 MicrobesOnline
⊟Phenotype[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟DNA sequence[edit | edit source]
- 1
61
121
181
241
301
361
421
481
541
601
661TTGTTAAAGTATGAACATATTGCTAAGCAACTTAATGCGTTTATACATCAATCTAATTTC
AAACCCGGTGATAAATTGCCAAGCGTGACGCAATTAAAAGAACGTTATCAAGTAAGTAAG
AGTACTATCATTAAAGCATTAGGCTTATTGGAACAAGATGGTTTGATCTATCAAGCACAA
GGCAGTGGTATTTATGTGAGAAATATTGCTGATGCCAATCGTATCAACGTCTTTAAGACT
AATGGTTTCTCTAAAAGTTTAGGTGAACACCGAATGACAAGTAAGGTACTTGTTTTTAAG
GAGATTGCAACGCCACCTAAATCTGTACAAGATGAGCTCCAATTAAATGCAGATGATACC
GTCTACTATTTAGAGCGATTAAGATTCGTGGACGATGATGTTTTATGTATCGAATATTCT
TATTATCATAAAGAAATCGTGAAATATTTAAATGATGATATTGCTAAGGGCTCTATCTTC
GACTATTTAGAATCAAACATGAAACTTCGTATTGGTTTTTCAGATATTTTCTTTAATGTA
GATCAACTCACTTCAAGTGAAGCTTCATTACTACAATTGTCTACAGGTGAACCATGTTTA
CGTTACCACCAGACTTTTTATACAATGACTGGCAAACCCTTTGATTCATCTGACATCGTA
TTTCATTATCGTCATGCACAGTTTTATATTCCTAGTAAAAAGTAA60
120
180
240
300
360
420
480
540
600
660
705
⊟Protein[edit | edit source]
⊟General[edit | edit source]
- locus tag: SACOL0249 [new locus tag: SACOL_RS01260 ]
- symbol: SACOL0249
- description: GntR family transcriptional regulator
- length: 234
- theoretical pI: 7.67897
- theoretical MW: 27013.6
- GRAVY: -0.359829
⊟Function[edit | edit source]
- TIGRFAM: Regulatory functions DNA interactions trehalose operon repressor (TIGR02404; HMM-score: 112.2)Regulatory functions DNA interactions phosphonate utilization transcriptional regulator PhnR (TIGR03337; HMM-score: 90.1)and 10 moreTransport and binding proteins Anions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)Regulatory functions DNA interactions phosphonate metabolism transcriptional regulator PhnF (TIGR02325; HMM-score: 77.2)Energy metabolism Amino acids and amines histidine utilization repressor (TIGR02018; HMM-score: 66.7)Regulatory functions DNA interactions histidine utilization repressor (TIGR02018; HMM-score: 66.7)phosphonate utilization associated transcriptional regulator (TIGR03338; HMM-score: 27.8)Fatty acid and phospholipid metabolism Biosynthesis fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)Fatty acid and phospholipid metabolism Degradation fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)Regulatory functions DNA interactions fatty acid metabolism transcriptional regulator FadR (TIGR02812; HMM-score: 17.4)Regulatory functions DNA interactions CRISPR locus-related DNA-binding protein (TIGR01884; HMM-score: 12.9)Unknown function General Rrf2 family protein (TIGR00738; HMM-score: 12.1)
- TheSEED :
- Transcriptional regulator, GntR family
- PFAM: UTRA (CL0122) UTRA; UTRA domain (PF07702; HMM-score: 95.6)and 12 moreHTH (CL0123) GntR; Bacterial regulatory proteins, gntR family (PF00392; HMM-score: 61.1)HTH_36; Helix-turn-helix domain (PF13730; HMM-score: 22.2)HTH_41; Helix-turn-helix domain (PF14502; HMM-score: 21.9)HTH_11; HTH domain (PF08279; HMM-score: 17.1)MarR_2; MarR family (PF12802; HMM-score: 16.2)Fe_dep_repress; Iron dependent repressor, N-terminal DNA binding domain (PF01325; HMM-score: 15.4)TBPIP; TBPIP/Hop2 winged helix domain (PF07106; HMM-score: 15.2)DnaD_N; DnaD N-terminal domain (PF21984; HMM-score: 14.9)Rrf2; Iron-dependent Transcriptional regulator (PF02082; HMM-score: 14.7)MarR; MarR family (PF01047; HMM-score: 14.1)HTH_DeoR; DeoR-like helix-turn-helix domain (PF08220; HMM-score: 12.9)RPA_C; Replication protein A C terminal (PF08784; HMM-score: 12.7)
⊟Structure, modifications & cofactors[edit | edit source]
- domains:
- modifications:
- cofactors:
- effector: Beta-glucoside-6-phosphate
- genes regulated by BglR*, TF important in Beta-glucosides utilizationRegPrecisetranscription units transferred from N315 data RegPrecise
⊟Localization[edit | edit source]
- PSORTb: Cytoplasmic
- Cytoplasmic Score: 7.5
- Cytoplasmic Membrane Score: 1.15
- Cellwall Score: 0.62
- Extracellular Score: 0.73
- Internal Helices: 0
- DeepLocPro: Cytoplasmic
- Cytoplasmic Score: 0.986
- Cytoplasmic Membrane Score: 0.0071
- Cell wall & surface Score: 0.0001
- Extracellular Score: 0.0069
- LocateP: Intracellular
- Prediction by SwissProt Classification: Cytoplasmic
- Pathway Prediction: No pathway
- Intracellular possibility: 1
- Signal peptide possibility: -1
- N-terminally Anchored Score: 1
- Predicted Cleavage Site: No CleavageSite
- SignalP: no predicted signal peptide
- SP(Sec/SPI): 0.00433
- TAT(Tat/SPI): 0.000361
- LIPO(Sec/SPII): 0.000474
- predicted transmembrane helices (TMHMM): 0
⊟Accession numbers[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Protein sequence[edit | edit source]
- MLKYEHIAKQLNAFIHQSNFKPGDKLPSVTQLKERYQVSKSTIIKALGLLEQDGLIYQAQGSGIYVRNIADANRINVFKTNGFSKSLGEHRMTSKVLVFKEIATPPKSVQDELQLNADDTVYYLERLRFVDDDVLCIEYSYYHKEIVKYLNDDIAKGSIFDYLESNMKLRIGFSDIFFNVDQLTSSEASLLQLSTGEPCLRYHQTFYTMTGKPFDSSDIVFHYRHAQFYIPSKK
⊟Experimental data[edit | edit source]
- experimentally validated: data available for NCTC8325
- protein localization: Cytoplasmic [1] [2]
- quantitative data / protein copy number per cell:
- interaction partners:
⊟Expression & Regulation[edit | edit source]
⊟Operon[edit | edit source]
- MicrobesOnline: no polycistronic organisation predicted
⊟Regulation[edit | edit source]
- regulator: BglR* (repression) regulon
BglR* (TF) important in Beta-glucosides utilization; RegPrecise
⊟Additional information (user-provided)[edit | edit source]
⊟Transcription pattern[edit | edit source]
- S.aureus Expression Data Browser: data available for NCTC8325
⊟Protein synthesis (provided by Aureolib)[edit | edit source]
- Aureolib: no data available
⊟Protein stability[edit | edit source]
- half-life: no data available
⊟Biological Material[edit | edit source]
⊟Mutants[edit | edit source]
⊟Expression vector[edit | edit source]
⊟lacZ fusion[edit | edit source]
⊟GFP fusion[edit | edit source]
⊟two-hybrid system[edit | edit source]
⊟FLAG-tag construct[edit | edit source]
⊟Antibody[edit | edit source]
⊟Additional information (user-provided)[edit | edit source]
⊟Other information (user-provided)[edit | edit source]
You can add further information about the gene and protein here. [edit]
⊟Literature[edit | edit source]
⊟References[edit | edit source]
- ↑ Dörte Becher, Kristina Hempel, Susanne Sievers, Daniela Zühlke, Jan Pané-Farré, Andreas Otto, Stephan Fuchs, Dirk Albrecht, Jörg Bernhardt, Susanne Engelmann, Uwe Völker, Jan Maarten van Dijl, Michael Hecker
A proteomic view of an important human pathogen--towards the quantification of the entire Staphylococcus aureus proteome.
PLoS One: 2009, 4(12);e8176
[PubMed:19997597] [WorldCat.org] [DOI] (I e) - ↑ Andreas Otto, Jan Maarten van Dijl, Michael Hecker, Dörte Becher
The Staphylococcus aureus proteome.
Int J Med Microbiol: 2014, 304(2);110-20
[PubMed:24439828] [WorldCat.org] [DOI] (I p)
⊟Relevant publications[edit | edit source]
Semen A Leyn, Marat D Kazanov, Natalia V Sernova, Ekaterina O Ermakova, Pavel S Novichkov, Dmitry A Rodionov
Genomic reconstruction of the transcriptional regulatory network in Bacillus subtilis.
J Bacteriol: 2013, 195(11);2463-73
[PubMed:23504016] [WorldCat.org] [DOI] (I p)